KEGG   Methylosinus trichosporium: CQW49_02145Help
Entry
CQW49_02145       CDS       T05155                                 

Definition
(GenBank) dihydroorotase
  KO
K01465  dihydroorotase [EC:3.5.2.3]
Organism
mtw  Methylosinus trichosporium
Pathway
mtw00240  Pyrimidine metabolism
mtw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CQW49_02145
Enzymes [BR:mtw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     CQW49_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 DHOase
Motif
Other DBs
NCBI-ProteinID: ATQ66828
UniProt: A0A2D2CVM8
LinkDB All DBs
Position
complement(451549..452844)
Genome map
AA seq 431 aa AA seqDB search
MTAPRPLLLADARLVDPATGVESRGGVLVLDGRIADLGPSITAASAPEGAQIVACGGDVV
APGLVDMQCFVGEPGAEHRETIASATAAAAAGGVTTIVAAPGTTPPVDDPAIVDFVLRRA
RDTGRVRVLPMATLTKGREGREISEYGLLRQAGAVAFCDGKRSLRNAQVMRRALTYARDF
EALVIHFPEDRDLAGEGVMNAGELATRLGLSGVPREAEAIVVDRDLRLVALTGARYHASI
VTAALSLDAIAAAKERGLPVTCGTSINHLTLNENDIGDYRTFLKLRPPLRHEDERGALVA
ALAAGLVDVIVSDHDPQDVETKRLPFAEAEAGAVGVETMLAAGLRLVHSGDVPLAGLLRA
MSTRPAEILGLEQGRLAKGAPADLIRFDPDEPFVVDPAELRSRCKNTPFATARLQGRVKL
TIVAGQAVFEA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgcctcgtcctctcctcctcgccgacgcccggctcgtcgatcccgcgaccgga
gtcgagagccgcggcggcgtgctcgttctcgacggacgcatcgccgatctcggcccttcg
atcaccgccgcctccgctccggagggcgcccagatcgtcgcctgcggcggcgacgtcgtc
gcgccggggctcgtcgacatgcaatgtttcgtcggcgagccgggcgccgagcatcgcgag
accatcgccagcgccaccgccgccgcggcggcgggcggcgtcacgacgatcgtcgccgcg
cccgggacaacgccgccggtcgacgatccggcgatcgtcgatttcgtgctgcgccgcgcc
cgcgacaccggccgcgtgcgcgtgctgcccatggcgacgctcaccaagggccgggaaggg
cgcgagatttccgaatatggcctgctgcgccaggcgggcgccgtcgccttctgcgacggg
aagcgctcgctgcgcaacgcccaggtgatgcgccgggcgctcacctacgcgcgtgatttc
gaggcgctcgtcatccatttcccggaggatcgcgacctcgccggcgagggcgtgatgaac
gcgggcgaattggccacgcgcctcggcctctccggcgtcccgcgcgaggccgaggcgatc
gtggtcgatcgtgatcttcggctcgtcgcgctgaccggcgcgcgctatcacgccagcatc
gtgaccgcggcgctttcgctcgacgccatcgccgcagccaaggagcgcggactccccgtc
acttgcgggacctcgatcaatcatctgacgctcaatgagaatgatatcggcgattatcgc
acctttctgaagctgcgcccgccgctgcgtcacgaggacgagcgcggcgctctggtcgca
gcgctcgccgccgggctcgtcgatgtgatcgtctccgaccatgatccgcaggacgtcgag
accaagcgccttccctttgccgaagccgaggccggcgccgtcggcgtcgagaccatgctc
gccgcaggtctgaggctcgtgcattccggcgatgtcccgctcgccggcctgctgcgcgcc
atgtcgacgcggccggcggaaattctcgggctggagcaggggcgcctcgccaagggcgcg
ccggccgatctcatccgtttcgatcccgacgagcccttcgtcgtcgatcccgccgagctg
cgctcgcgctgcaagaacacgcccttcgccacggcgcggctgcagggccgggtgaaattg
accatcgtcgcgggacaagccgtcttcgaagcctga

DBGET integrated database retrieval system