KEGG   Methylosinus trichosporium: CQW49_02160Help
Entry
CQW49_02160       CDS       T05155                                 

Definition
(GenBank) septation inhibitor protein
Organism
mtw  Methylosinus trichosporium
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIC ZapB
Motif
Other DBs
NCBI-ProteinID: ATQ70178
UniProt: A0A2D2D579
LinkDB All DBs
Position
complement(453781..454116)
Genome map
AA seq 111 aa AA seqDB search
MLRFVLRSLLLPALLYCAAGLVASYFVWHGVNGQRGLKAGEEYAERLAALEREHAGLVAE
RKQWERRIALLRGDVIDADMLDEQARVTLGRIHRNEVVILAPQLGRREEEK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcttcgtcctgcgctccctattgctcccggctctgctctattgcgcagccgga
ctggtcgcgagctatttcgtctggcacggcgtcaacggccagcgcggcctcaaggccggc
gaggaatatgccgagcgcctcgccgcgctcgagcgcgagcacgccggcctcgtcgccgag
cgcaagcaatgggagcgccgcatcgccctgctgcgcggcgatgtgatcgacgccgacatg
ctcgacgagcaggcccgcgtgaccctcggccgcatccaccgcaacgaggtagtgatcctc
gcgccgcagctggggaggcgggaggaggagaagtga

DBGET integrated database retrieval system