KEGG   Methylosinus trichosporium: CQW49_05560Help
Entry
CQW49_05560       CDS       T05155                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mtw  Methylosinus trichosporium
Pathway
mtw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mtw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CQW49_05560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtw02000]
    CQW49_05560
Enzymes [BR:mtw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CQW49_05560
Transporters [BR:mtw02000]
 Other Transporters
  Pores ion channels [TC:1]
   CQW49_05560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N
Motif
Other DBs
NCBI-ProteinID: ATQ67419
UniProt: A0A2D2CXQ2
LinkDB All DBs
Position
complement(1163415..1164068)
Genome map
AA seq 217 aa AA seqDB search
MPATTLTISSKNYSSWSLRGWLMMKLSGVDFEEVVVSPDDVAARAEILLLSPSILVPCLT
YDGAKIWDTLAIGEFLNEIAPAAGLLPADRMRRAHCRSICGEIHSGFTSLRSALPMNLKA
HFPKFKVWSKAQGDIARVTQLWRECLGAYGGPYLFGQISIADAMYAPVATRFRTYDVPLD
DVSQAYCDRILAWPAMQEWIAAAQLEKEEIEELEVEF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgacgacgctcacgatcagcagcaagaattattcgtcatggtccttacgagga
tggctgatgatgaagctgtccggcgtcgacttcgaggaggtcgtcgtcagccccgacgat
gtggcggcgcgggcggagattctgctgttgtcgccctcgatcctcgtgccctgcctcacc
tatgacggcgccaaaatctgggacactctggcgatcggtgagttcctgaacgagatcgcg
ccggcggcggggctgctgcccgccgaccgcatgcgccgcgcccattgccgctccatctgc
ggcgagattcattcgggcttcacctctctgcgctcggcgctgccgatgaatttgaaagcg
cattttccgaagttcaaagtctggtcgaaggcgcagggcgacattgcgcgggtgacgcag
ctgtggcgcgaatgcctcggcgcctatggcggcccctatctcttcggccagatctccatc
gcggacgcgatgtatgcgccggtggcgacgcgcttccgcacctatgacgtgccgctcgac
gatgtgagccaggcctattgcgaccgcatcctcgcctggccggcgatgcaggaatggatc
gccgccgcccagctcgagaaggaggagatcgaggagctggaggtcgagttctaa

DBGET integrated database retrieval system