KEGG   Methylosinus trichosporium: CQW49_17665Help
Entry
CQW49_17665       CDS       T05155                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
mtw  Methylosinus trichosporium
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ATQ69503
UniProt: A0A2D2D3C7
LinkDB All DBs
Position
complement(3718878..3731990)
Genome map
AA seq 4370 aa AA seqDB search
MTLSSTKFTSASVRPDSDNLVNLLRMRAADQSTKLAYLFLDDGEREGARTSFADLDLRAR
AIAARLASAGAKGARALLLYPPGLPYIEAFFGCLYAGVVAVPAYPPSGRHFDRLRSIVLD
SQPSIILTTEAMRLRFETSEDIPTTAAGWIATDQIDVAASADWRPYAPTAGDLAFLQYTS
GSTAEPRGVMISHGNLMSNQALIAESFGHGPDSDLVGWLPLYHDMGLIGNILQPMYVGAT
AYLMSPMAFLEKPARWLQAISRYGARTSGGPNFAYDLCVRKMKEEDKRDLDLSEWRVAFS
GAEPVRAKTLDGFARAFADCGFRRDAFTACYGLAEATLVVTAPTGERPIPIIEIDRAALD
AGRMLRAATGRSLSFVGCGHAWPGYEVAIVDPERSTRCGPAAVGEIWVAGPGVARGYWER
PEDSARVFGARIAGEDRGPYLRTGDLGFFEDGELFIAGRLKDMIIVAGRNIHAQDVEAAI
EQRVADLRPGAVAALSLTQADEERLVVIAEPDRAAAAASESAHADILTLIRRCVAEDLGV
EPAHVVLARPGSIPKTSSGKLRRSECRRLLLADELTVIAQWSRARPEAEATLKRHEAAPR
PSAFLRQAMSYVDAEQRAALLRRFLSTSAAEILDMSEREVSDAASFVDVGLSSLRAVELK
HRIDAALDIDAPIELLLSNVSMATAADAMLRIVDGSTPPSLGAAPHERRDSALSFTQRSM
WTIHRLEGAGEAYNLHLAIGFEAPIDVERLQRAIHCLVERHEQLRTVFRPCAGEDMAERV
ALNDAPLVLRVEKAAHWSDAELRDAMSKEARRSFDIENEPPLRVVLYRVTEDRHALLFVA
HHIAVDQWSLVLLLDELDRCYRGEAQTAAEPRYGAFVAAEADYLASAAAERDWTYWREQL
AGPLPVLDLPQDFRRAGRRDYRGGSTLLMIDDSATRRLKDLARREGVSLYSALLTVYFAL
LRRSCGQDDIIVGGAASGRLDHAAAATVGNCVNPIAIRSKIAPQDRFIDLLRRVNEQVKG
AIVHQRFPFQLVVERLNPVRVDDQWPIYQTWFVLQQAQGGAPSAAAALSLGEELGAIDLL
GVAAKPVALSNRVEMFDLKVMAAEHEGRLALSFQFSEQVLSRSSVAAMADRYARLLDALL
RSPDCRIGDAHMLDEAERRTILVRSTGDELSAPRETLLHDLIGADARSDDIAVVAEDGSL
TYGELRLRANQIARLLQRAGIGPETPVGVLLDPGLDYVASVLGVLVAGGAFVPLDPAYPS
ERLRYMLADSGARALISAQSLPRLDCVIPKILVDADELADVSNDAVVSSAHPDNLAYIVY
TSGSTGGAKGVMATHRNAVASLLARFAFYPQTVDDFLLLSSLSFDSSFAGLFWTLARGGR
LHLVAETTRRDPVALKEIIASRDITHFLCLPSFHRELLGELSRGERTMLKCCIVAGEACG
ADVVERHFHTLPEAALINEYGPTECSVWCAAEQLSTEDDLSSGVSIGRAIPGSRAYVLDE
NGELAPVGIAGELCVGGAGVARGYRGGAELTATKFTPDPFGFGERLYRTGDRARYRADGK
LEFMGRSDQQVKIRGHRIEISEVEDVLSRLPGVREAAVVARADATGDKRLVAYVVGELEP
RAVKEAFRSEAPHYMTPHFVVALQRLPRLDNGKVDRKALPAPDVDALLSERYVAPTTETE
AAICAVFAETLGLARVGADDDFFDLGGDSIRAIQAASALRLRGYEAAPRDFFQYPTAASL
APRLRVAKDGTEPTRERRSTPFSLAQLGATDVERLKAVHGDAQDIYPLTPMQEGMLFHAL
SQQGTGLYLMQDRYEIKGALDIDAFLEAWRRVIDRHDILRTSFDWSSEGRPHQIVHRAAA
LPFEVTDLSGATEQEQTNAIDRALAAEREAGFDLAQAPLMRIRIFRLADDRHICVRSFHH
IILDDWCTSLLILDVRRHYAAVRKGEATEFAPAPQFWRYIEWIAEQSERTAEQFWRAHLD
GFVEPTPLVGAKPSTRDAVSFVEDIVVDLSNEMYERLRALVQQRRLTLNTFVQGALALTL
GRAGGVDDVVFGVTASGRPIDLDGADATLGLFINSLPLRVRIDRRKPVIDWLREILADNL
EMRQYEFVPQTNIQRWSAISRSDAPLFQHLLTFENAPLDPSVRGEKDVLDIDLLQLRVHT
NYPLTFVAIPGETLGLRLTYDRERFDAETVQRIAEAFRRSLEQLIVNCDSRLCELALLSP
AEVEELTVAWNATDRDHGEPLDLVARFEAQAATAPNRIAAACGDGSIRYGELNARANRLA
HALIQCGVGPDVVVALLDDRGVDFLVAILAIFKAGGAYLPLDPAHPDGRIAQVLAESEVA
LLAAGAALRNRAHDIAATLGDDQPRLLDLATLEASESRTDNPPRRHAPDNLAFVIFTSGS
TGKPKGAMVEHRGMFNNLVTKIPALALTENDVIAQTASQCFDISVWQFLTALTIGARVEI
FPDAVSRDPQRLAADIARGVTILEAVPSMIRALLELADSDASIDGLRWLLPCGEAFAPEL
CRRFMERYPQVRLLNAYGPAECSDDVTYHPIIEPPIGDELSVPIGRPVDNTKIYLLDRWL
DPAPIGVDAEICVAGVQVGRGYLGRADLTAASFAPDPFGPPGSRLYRTGDLGRYRADGVI
EFLGRVDHQVKIRGHRIEPGEVEACLSAHVDVCAAAVVAREASRGVYRLVAYVVGRDREP
EPEELRAYLRQSLPDYMIPSAFVNLGALPLTRNGKVDRKALPEPDIAAQLADKFVAPRND
AERALAKIWADVLRVDAVGVHDNFFELGGDSILSIQIVSRARRAGLTLMPKQIFDLPTVA
QLAEAARAQSAIVEEGVVAGEAPLTPIQHWFFEQELDEPHHWNLAVLLELRDEMTPADFE
TATRRLVEHHDALRMRFTQRERGWSAFVAPSEEGDVFHVEDLSSVPAEAHEETIAARATQ
WQRRFDLAAGPLFRIVWFDLGASAKPRILLAAHHLVVDGVSLRILLEDMESACRQAKSGR
AITLPAKTTSYRTWARRLSQTAIPPGDIDYWSALDEIEAQPLHVENPRGSRRRRHGAEAR
VALDAETTRALLQDAPAAYHTRINELLLASFARAVCAWTGSNVVTIDLEGHGREDVIAGV
DVSRTVGWFTSIYPVRLQDVLESDPEQLIKSVKEQLRRIPTNGFYHGVRRYLRDEGGARG
DILFNYLGRLDQALSPDSPFAPATGASGENLSLEGSFSHEWEIVGDVTDGCLRLCWRFSA
ERYSRSTIEALAAEWKRELEGLVRHCLDVETSSFTPSDFPLSTLGQADLDRLITDPANVE
DIYPAAPMQQGLLLHTLLDPHSGIYLMQDVIELKADLDVDAFRHAWRQVVDSHSMLRTAF
YWTTDERPHQIALKSVPMPCELFDWRDLEEEERGLQLQTMLHDELTSGLTLDRAPILRMR
LIRTGPDRWTYIRSHHHIMLDAWCLPLLLADFLRYYEAALRGAPAPTRVATPYRAYIAWL
QRQDLDAAQSYWREALAGFRTPTFLAAKRPRRSLAPGEVEVTDAQAELSKEDTTALHEAC
RRHRLTTSAFLQGAWALLMVHYLNRSEIVFGVTVAGRPGELDRVEDMAGLFINTLPCRVT
VEPSARIADWLRRLLSQTAEMRQYEYAPLTDIQKWSEIERGEQLFDSFVVYENVPVNESL
RRSELPLEVLSYSSRTHSNYPLNLSVMPNERLHLRLTYNQTLLDAESADRMVDHYRRLLE
GMIRTPDSRVCELALLSPAEVEELTVAWNATDRDHGEPLDLVARFEAQAATAPNRIAVAC
GDVSIRYGELNMRANKLAHALSRCGVGPDVVVALLDDRGVDFLVAILAIFKAGGAYLPLD
PAHPDGRIAQVLAESEVALLAAGAALRNRARDIAATLGDDQPRLLDLATLEASESRTDNP
PRRQAPDNLAFVIFTSGSTGKPKGAMVEHRGMFNNLVTKIPALGLTENDVIAQTASQCFD
ISVWQFLTALTIGARVEIFPDAVSRDPQRLAAEIARGVTILEAVPSMIRALLELADSDAS
IDGLRWLLPCGEAFAPELCRRFMERYPQVRLLNAYGPAECSDDVTYHPIIEPPMGDELSV
PIGRPVDNTKIYLLDRWLDPAPIGVDAEICVAGVQVGRGYLGRADLTAASFAPDPFGPPG
SRLYRTGDLGRYRADGVIEFLGRVDHQVKIRGHRIEPGEVEACLSAHVDVCAAAVVAREA
SRGVYRLVAYVVGRDREPEPEELRAYLRQSLPDYMIPSAFVNLGALPLTRNGKVDRKALP
EPDIAAQLADKFVAPRNDAERALAKIWADVLRVDAVGVRDNFFELGGHSLLMTQIASRIQ
MAFDIQIPLRSLFEARTVAEMAEVVNAGLSARAGREIASPANGDYEVIDL
NT seq 13113 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgtcatcgacgaaattcacgagcgcgagcgtgcgccccgacagcgacaatctg
gtgaatcttctgcgcatgcgcgccgccgatcaatcgacgaagctcgcctatctctttctc
gacgacggcgagcgcgaaggcgcgcggacgagcttcgccgacctcgatcttcgtgcgcgc
gccatcgccgcgcgtctcgcctccgccggagcaaaaggcgcgcgcgcgctgcttttgtat
ccgccgggacttccctatatcgaagccttcttcggctgcctctacgccggcgtcgtcgcc
gttcccgcctatcctccatcgggccgtcacttcgaccgcctgcgatcgatcgtcctcgat
tcgcaaccttcgatcattctgacgaccgaggctatgaggcttcgcttcgagacgagcgag
gacattccgacgaccgcggccggctggatcgccaccgaccagatcgacgtcgccgcgagc
gccgactggcgcccctatgctccgaccgcgggcgacctcgccttcctgcaatatacgtcc
ggctccaccgccgagccgcgcggcgtgatgatctcccatggcaatctcatgagcaatcag
gcgctgatcgccgagagcttcggccacggccccgattccgatctcgtgggatggctgccg
ctctatcacgacatgggtctcatcggaaatattctgcagcccatgtatgtcggcgccacc
gcctatctcatgtcgccaatggcgtttctggaaaagccggcgcgctggctgcaggcgatc
tctcgctatggcgcgcgaaccagcggcggaccgaacttcgcgtatgatctctgcgtgcgc
aagatgaaggaggaggacaagcgcgacctcgacctgagtgaatggcgtgtcgccttcagc
ggcgccgagccggtgcgcgccaagacgctcgacggcttcgcacgcgcattcgccgattgc
ggctttcgccgcgacgccttcaccgcctgctacggactcgccgaagccactctcgtcgtg
acggcgccgacgggcgagcgtccgattccgatcatcgagatcgacagggccgcgctcgac
gccgggcgcatgctgcgcgccgcgaccggacgctcgctctccttcgtcggatgcggccac
gcctggccgggctatgaggtcgcgatcgtcgatccggagcgctcgacgcgctgcggtccc
gccgccgtcggagagatctgggtcgccgggccgggagtcgcacgcggctattgggaacgg
ccagaggatagcgcgcgcgtgttcggggcgcgcatcgccggcgaagatcgagggccttat
ctgcggaccggcgatctcggcttcttcgaggatggcgagcttttcatcgctggacgattg
aaagacatgatcatcgtcgccggacgcaatattcacgcgcaggatgtcgaggcggcgatc
gagcagcgcgtcgccgatctgcgtccgggcgccgtcgccgctctctcgctcacacaggcc
gacgaggagcggctcgtcgtgatcgccgagcccgatcgcgcggccgccgcggcgagcgag
agcgctcacgccgacatcctcactctcattcgccgctgcgtcgccgaagatctcggcgtc
gagccggcgcatgtcgtgctggcgcgcccaggctccattcccaagacatcgagtggaaag
ctgcgccgctccgaatgccgccggctgctcctcgccgatgaattgaccgtgatcgcgcaa
tggagccgcgcgcggcccgaggccgaagcgacgttgaagcgacacgaagcggcgccgcgc
ccgagcgccttcctgaggcaagcgatgagctatgtcgacgccgagcaacgcgctgcgctg
ctgcgacggttcctgtcgacgagcgccgccgagattctcgacatgtccgagcgcgaggtg
agcgacgccgcctccttcgtcgacgtcgggctgagctcgcttcgcgctgtcgagctgaag
catcgcatcgacgccgctctcgacatcgacgcgccgatcgagctgctgctctcgaatgtg
agcatggcgacggccgccgacgccatgctgcggatcgtcgatgggagcacgccgccctca
ctgggcgctgcgccgcatgagcgtagggattcggccctctccttcacgcagcgctccatg
tggacgatccatcgtctcgaaggcgcgggcgaagcctataatctgcatcttgcgatcggc
ttcgaggcgccgatcgacgtcgagcgtctgcagcgcgcaattcactgcctggtggagcgg
cacgagcagctgcgaaccgtgtttcggccatgcgccggcgaagacatggccgagcgcgtc
gctctgaacgacgcgccgctggtcctgcgcgtcgaaaaagccgcgcattggagcgatgcg
gagctgcgcgacgcaatgtcgaaggaggcgcgccggtcattcgacatagagaacgagccg
ccgctgcgggtcgtgctctatcgtgtcaccgaggaccgccatgcgctcttgttcgtcgcg
catcacatcgccgtcgatcaatggtcgctggtcctgctgctcgacgagctcgaccgctgc
tatcgcggcgaggcgcagacggccgccgagccgcgctatggcgccttcgtcgccgctgaa
gccgattatctcgcctccgccgcggcggagcgcgattggacctattggcgcgagcagctc
gccgggccgcttccggttctcgatctgccgcaggattttcgccgcgcaggccgccgcgac
tatcgcggcggatcgacgcttctcatgatcgacgacagcgcgacgcgtcgactgaaggac
ctcgccagacgcgagggcgtcagcctctattcggcgctgctcaccgtctatttcgcgctg
ctgcgacgctcctgcggacaggacgacatcatcgtcggcggcgccgcgagcgggcgtctc
gaccacgccgccgccgcaaccgtcggcaattgcgtcaatcccatcgccataagatcgaag
atcgcgcctcaggatcgcttcatcgatctgctgcgccgagtgaatgaacaagtgaagggc
gcgatcgtccatcagcgctttccgttccagctcgtcgtcgagcgcctcaatcccgtccgc
gtcgacgatcaatggccgatctatcagacctggttcgttctgcagcaagcgcagggcggc
gcgcccagcgccgcggcggctctgtcgctgggcgaggagctcggcgcgatcgatctgctc
ggcgtggcggcgaagcccgtggcgctgagcaaccgcgtcgaaatgttcgacctcaaggtg
atggcggcggagcacgagggtcgtctcgccctttcctttcaattcagcgagcaggtgctg
tcgcgctcgtccgtcgcggcgatggccgatcgctatgcgaggctcctcgacgctctgctg
cgatcgcccgactgtcgcatcggcgacgcccacatgctcgacgaagccgagcggcgaacg
attctcgtccgatcgacaggcgatgagctgagcgcgccgcgcgaaacattgctgcacgac
ctcatcggcgcggacgcgcgcagcgacgatatcgccgtcgtcgccgaggatggatcgctg
acctatggcgaattgcgtctgcgcgccaatcaaatcgcgcgcctgctgcaacgagcggga
atagggccggagacgcccgtcggcgtgctcctcgatcccggactggattatgtcgcgtct
gtgctcggcgtgctcgtggcgggcggcgccttcgttccgctggacccggcctatccgtcg
gagcggctgcgttacatgctcgcagattccggcgcgcgcgccttgatctccgcgcaaagc
ctgccacgcctcgactgcgtgattcctaagattctcgtcgacgccgacgagctcgcggat
gtttcgaatgacgccgtggtctccagtgcccatcccgacaacctcgcttatatcgtctac
acctccggctccacgggaggcgccaaaggcgtgatggcgacgcatcgcaatgcggtcgcg
tccctcctcgcgcgcttcgccttctatccgcagacggtcgacgactttctgcttctctcc
tcgctttccttcgacagctcctttgcgggattattctggacgctggcgcgcggcggacgg
ctccatctcgtcgccgagacgacgcgccgcgatcccgtcgcgttgaaggagatcatcgcg
agccgcgacatcacccatttcctctgtctcccctccttccaccgcgagctgctcggagag
ctctcgcgcggagagcggacgatgctgaaatgctgcatcgtcgccggcgaggcctgcggc
gccgatgtggtcgagcgccattttcacacgcttccagaagcagcgctgatcaatgaatat
ggtccgacggaatgctcggtctggtgcgccgccgagcagctgagcacggaagacgatctc
tcatcgggcgtcagcatcggccgcgcgattcccggctctcgcgcttatgttctcgatgaa
aatggcgaactcgcgccagtcggaatcgccggcgagctctgcgtgggcggagcaggagtc
gcgcgcggctatcgcggcggcgcggagctgaccgcgacgaaattcacacccgatccgttc
ggcttcggcgagcgtctctatcgcaccggggatcgcgcgagatatcgcgcggatggaaag
ctcgaattcatgggccgctccgaccagcaggtgaagattcgcggtcatcgcatcgaaatc
tccgaagtggaggatgtgctgtcgcgactgcccggcgtccgcgaggcggcggtcgtggcg
cgagccgacgcaaccggagacaagcggctcgtcgcttatgtcgtcggcgagctcgagccg
cgggcggtgaaagaggcgtttcgaagcgaggccccgcactatatgacgccgcatttcgtc
gtggcgctgcagcgcctgccgcggctcgacaatggcaaggtcgatcgcaaggcgcttccc
gcgccggacgtcgacgctttgcttagcgaacgctatgtcgcgccgacgaccgagacggaa
gcagcgatctgcgccgtgttcgccgagacgctcggcctcgcgcgcgtcggcgccgacgac
gacttcttcgatctcggcggcgattcgatccgcgcaattcaggcggcgagcgcgctgaga
ctgcgaggatatgaggcggcgccgcgcgatttcttccaatatccgaccgcagcgtctctc
gctccgcgcctgcgcgtcgcgaaagacgggacggagccgactcgcgagcggcgttcgacg
cccttctctctcgcccagctcggcgcaaccgatgtcgagcgattgaaggctgtgcatggt
gacgctcaggatatatatccgctcacgcccatgcaggaaggcatgttgttccatgcgctc
tcgcagcaggggaccggcctctatctgatgcaggaccgctacgagatcaaaggcgcgctc
gatatcgacgccttcctagaagcgtggcggcgcgttatcgaccggcacgacattctacgc
acctccttcgactggtcgagcgaaggacggccgcatcaaatcgtgcatcgcgccgcggcg
cttcccttcgaggtcacggatctgagcggagccacggaacaggagcagacgaacgcgatc
gatcgcgcgctcgccgccgaaagggaagcgggcttcgacctcgcgcaggcgccgctcatg
cgcatccgcatctttcgcctcgcagatgatcgtcacatctgcgtgcgcagcttccatcac
atcatattggacgactggtgcacgtctttgctcatcctcgacgttcgccggcactatgcc
gctgtgcgaaagggagaggccacggaatttgcgccggcgccgcagttctggcgctatatc
gaatggatcgcggaacagagcgagcggacagccgagcagttctggcgcgcccatctcgac
ggattcgtcgagccgacgccgctcgtcggggcgaaaccgtcgacacgcgacgccgtctcc
ttcgtcgaggatatcgtcgtcgacctttccaacgagatgtacgagcggctcagagcgctc
gttcagcaacgccggctgacgctgaacactttcgtgcaaggagcgctcgcgctcactctc
ggacgcgccggcggggtcgacgatgtcgtcttcggcgtcaccgcgtccggccggccgatc
gatctcgacggcgccgacgcgacgctcgggctattcatcaacagcctgcccttgcgcgtc
aggatcgaccgacgcaagcctgtcatcgattggctccgcgagattctcgcggacaatctc
gagatgcgccaatatgagttcgttccccagacgaacatccagcgctggagcgccatctcg
cgctccgacgcgccgctcttccagcatctgctgaccttcgagaacgcgccgctcgaccca
tccgtgcgaggggagaaggacgtgctcgacatcgatctgctgcagctgcgcgttcacacc
aattatccgctcaccttcgtcgccattcccggcgagaccctcggcctgcgcctcacttat
gatcgcgagcgcttcgacgccgagacggtgcagcggatcgcagaggcgttccggcgctcg
ctggagcagctgatcgtcaattgcgattctcgcctctgcgagctggcgctgttgtcgcca
gcggaggtggaggagctgacggtcgcctggaacgcgacggatcgcgatcatggcgagccg
ctcgatctcgtcgcgcgcttcgaggcgcaagcggcgacggcgccgaaccgcatcgccgcc
gcctgcggcgacggctccattcgctatggcgagctgaatgcgcgcgccaatcgcctcgcc
cacgccttgatccaatgcggcgtcggacccgatgtcgtcgtcgctctgctcgatgatcgc
ggcgtcgacttcctcgtcgccattctggcgatcttcaaggccggcggcgcctatctgccg
ctcgatcccgcgcatccagacgggcgcatcgcgcaagtgctcgccgagagcgaggtcgct
ctgctcgccgccggcgccgccctgcgcaaccgcgcccacgacatcgctgcgacgctcggc
gacgaccagccgcgcctgctcgatctcgcaacgctcgaagcgagcgagagccgcacggac
aatccgccgcgtcgtcacgcgccggacaatctcgccttcgtcatcttcacctccggttcc
actggaaagcccaagggcgcgatggtcgagcatcgcggaatgttcaacaatctcgtcacc
aagattcccgcgctcgccctcaccgaaaatgatgtgatcgcccagaccgcatcgcaatgt
ttcgacatctccgtctggcaattcctcaccgcgctcaccatcggcgcgcgcgtcgagatc
ttccccgacgccgtctcgcgcgatccccagcgtctcgccgcggacatcgcgcgcggcgtc
accatattggaggcggtgccgtcgatgatccgcgcgctgctcgagctcgccgacagcgac
gcgtcgatcgacggattgcgctggctgctgccttgcggcgaggccttcgcgccggagctg
tgccggcgattcatggagcgctatccgcaggtgagactgctcaacgcctatggccccgcc
gaatgttcggacgatgtgacctatcatccgatcatcgagccgccgattggcgatgagctc
agcgttccgatcggacgcccggtcgacaatacgaagatctatcttctcgatcgctggctc
gatccggcgccgatcggcgtcgacgccgagatttgcgtcgccggcgtgcaggtggggcgc
ggctatctcggacgcgccgatctcaccgcggcgtccttcgcgcccgatcccttcggcccg
cccggctcgcgcctctatcgcaccggcgatctcggccgctatcgcgccgatggcgtcatc
gaatttctcggccgcgtcgatcatcaagtgaagatccgcggccatcgcatcgagccggga
gaagtcgaggcctgcctctccgctcatgtcgacgtctgcgcggccgctgtggtcgcgcgc
gaagcgtcgcgcggcgtctatcgactcgtcgcttatgtggtcggccgcgatcgtgagccg
gagccggaggagctgcgcgcctatctgcgtcagagcctgcccgattatatgattccgtca
gcctttgtgaacctcggcgcgctgccgctgacgcgcaacggcaaggtcgatcgcaaggcc
ctgccggagcccgacatcgccgcgcagctcgccgacaaattcgtcgccccgcgcaatgac
gccgaacgcgccctcgctaaaatctgggccgacgtcctgcgcgtcgacgccgtcggcgtc
cacgataatttcttcgagctcggaggcgattccattctcagcattcagatcgtcagccgg
gcgcgccgcgccgggctgacgctgatgcccaagcagatcttcgaccttcccacggtggcg
cagctcgccgaggcagcgcgcgcgcagtcggcgatcgtggaagaaggcgtcgtcgcgggc
gaggcgccgctgacgcccatccagcattggttcttcgagcaggagctcgacgagccccat
cattggaatctcgccgtcctgctcgagctgcgcgacgaaatgacgccggctgatttcgag
acggcgacgcgccgtctcgtcgagcatcatgacgcgctgcgcatgcgcttcacccagcga
gaaagaggctggtcggctttcgtcgcgccctcggaggaaggcgacgtctttcacgtggaa
gacctgtcctcggttcctgccgaagcacatgaagagacgatcgccgcgcgggcgacgcag
tggcagcgacgtttcgatcttgcggccgggccgctgtttcgcatcgtctggttcgatttg
ggcgcgtcggcaaaaccacgcattctcctcgccgcgcatcatctcgtcgtggacggagtc
agcctgcgcatcctgctcgaggatatggaaagcgcctgccggcaggcgaagagcgggcga
gcgatcacgctcccggcgaagacgacctcctaccggacatgggcgcgacgcctgtcgcag
acggcgattccacccggcgacatcgactattggtcggcgctcgacgagatcgaggcgcag
ccgcttcacgtcgagaaccctcgcgggtcgcgccggcggcggcacggcgccgaagcgcgg
gtcgcgctcgacgccgagacgacgcgggcgctactgcaagacgcgccggcggcctatcac
acgcgcatcaacgagctgctgctcgcatccttcgcgcgcgctgtctgcgcctggacggga
tcgaacgtggtcacgatcgatctcgaaggacatgggcgcgaggatgtgatcgccggagtc
gatgtgagccgcacggtcggctggttcacgagcatctatccggtgcggctgcaggacgtt
ctcgagagcgatcccgaacagctgatcaaatcggtcaaggagcagctgcggcgcataccg
accaatggcttctatcatggcgttcggcgctatctgcgcgacgaaggcggcgcgcgcggc
gatatcctcttcaactatctcggccggctcgatcaggccctctcgcccgattcgcccttc
gccccggcgacgggcgcgagcggggaaaatctctcgctcgaaggaagcttcagccatgag
tgggagattgtcggcgatgtgaccgacggctgcctgcgcctctgctggcgcttcagcgca
gagcgctattcgcgctcgaccatcgaagctctcgccgccgaatggaagcgcgagctggaa
gggctcgtgcgtcattgcctcgacgtcgagacatcgagcttcacgccatcagacttcccg
ctgtcgacgctcggacaagccgatctcgacaggctgatcaccgatcccgccaatgtcgag
gatatctatcccgcggcgccgatgcagcagggattgctgctgcacacgctgctcgaccca
cattccggcatttatctgatgcaggacgtgatcgagctgaaggccgatctcgacgtcgac
gcgttccggcatgcatggcgccaggtcgtcgattcgcattcgatgctacggacggcgttt
tattggacgacggacgagcggcctcaccagatcgcgctgaaatcggtcccaatgccgtgc
gagctgttcgactggcgcgacctcgaagaggaggagagaggactgcagctgcagacgatg
ctccatgacgagcttacctccggcctcactctcgatcgcgcgccgatcctgcgcatgcgc
ctcatccgcaccgggccggatcgctggacctatattcgcagccatcatcacatcatgctg
gacgcctggtgtctgccgctgctgctcgccgattttctgcgctactatgaggcggcgctc
aggggcgcgccggcgccgacgcgcgtcgccacgccctatcgcgcctatatcgcatggctg
cagcgccaggacctcgacgcggcgcagagctattggcgcgaggcgctcgcaggattcagg
acgccgacgtttctagcggcgaaacgtccccggcgctcgctcgcgccgggagaggtcgag
gtgaccgatgcgcaggccgagctctccaaggaggacacgaccgcgctgcatgaggcctgc
cgcaggcatcggttgacgaccagcgcgtttctgcagggcgcatgggcgctgctgatggtc
cattatctcaaccgcagcgaaatagtgttcggcgtcactgtggccgggcgtccgggcgag
ctcgaccgcgtcgaggacatggcggggctgttcatcaacactctgccctgccgggtcacg
gtggagccgtccgcgcgcatcgccgactggctgcgccgtctgctgtcgcaaacggcggag
atgcggcaatatgaatatgcgccgctcaccgacattcaaaaatggagcgagatcgaacgc
ggcgagcagctcttcgacagcttcgtcgtctatgagaatgtgccggtgaacgaatcgctg
cgtcgcagcgagctgccgctcgaagtgctgagctattcgtcgcggacgcattcgaactat
ccgctcaatctcagcgtcatgcccaatgagaggctgcatctgcgcctgacctataatcag
acgctgctcgatgcggagtcggccgaccgaatggtcgatcactatcgtcgattgctcgag
ggcatgatccgaacgcccgattctcgcgtctgcgagctggcgctgttgtcgccagcggag
gtggaggagctgacggtcgcctggaacgcgacggatcgcgatcatggcgagccgctcgat
ctcgtcgcgcgcttcgaggcgcaagcggcgacggcgccgaaccgcatcgccgtcgcctgc
ggcgacgtctccattcgctatggcgagctgaacatgcgcgccaataagctcgcgcacgcc
ttgagccgatgcggagtcggacccgatgtcgtcgtcgctctgctcgatgatcgcggcgtc
gacttcctcgtcgccattctggcgatcttcaaggccggcggcgcctatctgccgctcgat
cccgcgcatcccgacgggcgcatcgcgcaagtgctcgccgagagcgaggtcgctctgctc
gccgccggcgctgccctgcgcaaccgcgcccgcgacatcgctgcgacgctcggcgacgac
cagccgcgcctgctcgatctcgcaacgctcgaagcgagcgagagccgcacggacaatccg
ccgcgccgccaggcgccggacaatctcgccttcgtcatcttcacctccggctccactgga
aagcccaagggcgcgatggtcgagcatcgcggaatgttcaacaatctcgtcaccaagatt
cccgcgctcggcctcaccgaaaacgatgtgatcgcccagaccgcatcgcaatgtttcgac
atctccgtctggcaattcctcaccgcgctcaccatcggcgcgcgcgtcgagatcttcccc
gacgccgtctcgcgcgatccccagcgtctcgccgcggagatcgcgcgcggcgtcaccata
ttggaggcggtgccgtcgatgatccgcgcgctgctcgagctcgccgacagcgacgcgtcg
atcgacggattgcgctggctgctgccttgcggcgaagccttcgcgccggagctgtgccgg
cgattcatggagcgctatccgcaggtgagactgctcaacgcctatggccccgccgaatgt
tcggacgatgtgacctatcatccgatcatcgagccgccgatgggcgatgagctcagcgtt
ccgatcggacgccccgtcgacaatacgaagatctatcttctcgatcgctggctcgatccg
gcgccgatcggcgtcgacgccgagatttgcgtcgccggcgtgcaggtggggcgtggctat
ctcggacgcgccgatctcaccgcggcgtctttcgcgcccgatcccttcggcccgcccggc
tcgcgcctctatcgcaccggcgatctcggccgctatcgcgccgatggcgtcatcgagttt
ctcggccgcgtcgatcatcaggtgaagatccgcggccatcgcatcgagccgggagaagtc
gaagcctgtctctccgctcatgtcgacgtctgcgcggccgctgtggtcgcgcgcgaagcg
tcgcgcggcgtctatcgactcgtcgcttatgtggtcggccgcgatcgtgagccggagccg
gaggagctgcgcgcctatctgcgccagagcctgcccgattatatgattccgtcagccttt
gtgaacctcggcgcgctgccgctgacgcgcaacggcaaggtggatcgcaaggccctgccg
gagcccgacatcgccgcgcagctcgccgacaaattcgtcgccccgcgcaatgacgccgaa
cgcgccctcgccaaaatctgggccgacgtcctgcgcgtcgacgccgtcggcgtccgcgat
aatttcttcgagctcggagggcactccctgctcatgacgcagatcgcatcccgcatccag
atggccttcgacattcagattccgctgcggtcgctcttcgaagcgcgcacggtcgcggaa
atggcggaggtcgtgaatgccggactttccgcgcgcgccggccgcgaaatcgcgtcgcct
gcgaacggtgattacgaggtgatcgacttgtga

DBGET integrated database retrieval system