KEGG   Methylosinus trichosporium: CQW49_19840Help
Entry
CQW49_19840       CDS       T05155                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mtw  Methylosinus trichosporium
Brite
KEGG Orthology (KO) [BR:mtw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CQW49_19840
Enzymes [BR:mtw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CQW49_19840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA FAD_oxidored Thioredoxin_3 DAO AlaDh_PNT_C FAD_binding_2 HI0933_like FAD_binding_3 NAD_binding_7 NAD_binding_8 Thi4 K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: ATQ69884
UniProt: A0A2D2D4K6
LinkDB All DBs
Position
complement(4201984..4203537)
Genome map
AA seq 517 aa AA seqDB search
MLDANLKSQLQGLFARIATPITLAASLDDGAKSAELAELCQEIASLSDKISYVRRDDDAR
RPSFAIERDGGGVSLRFAAVPGGHEFNSFVLALLHVGGHPPKEAEETLERVKALDGDYRF
ETYFSLTCQSCPEVVQALDLMAALNPRVSHVAIDGALFPREVEERQIMAVPSVFLNGEPF
QHGRATLEQILDKLDAGAGEKQAATLSAKAPYDVLIVGGGPAGAAAAVYAARKGVRTGIV
AERFGGQVQDTAGIENFISVPHTEGPEMAAALQRHVAEYGVDVMNGQIAAALVPASEPGA
LAELRLVNGAVLRSKTIVLAPGARWRRINVPGETEYMTKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGLTAHVTLIEYDSKLRADGILQDKLRSLPNVEIIVSAQTTEIRGDG
AKVTGLSYRDRESGDTRDITLDGVFVQIGLLPSTEWLKGAVTLSRFGEIEIDRRCATSAP
GVFAAGDATIVPYKQIVIAMGEGATAALSAFDHLVRM
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctgaaaagccagctgcagggcctcttcgcgcgcatcgccacgccg
atcacgctcgccgcctcgctcgacgacggcgcgaaatcggccgagctcgccgagctctgc
caggagatcgcctccctctccgacaagatttcctatgtgcgccgcgacgacgacgcccgc
cgcccctctttcgcgatcgagcgcgacggcggcggcgtctcgctgcgcttcgccgccgtg
cccggcggccatgagttcaactccttcgtcctcgccctgctccatgtcggcggccatccg
cccaaagaggccgaggagacgttggagcgcgtgaaggcgctcgacggcgactatcgcttc
gagacctatttctcgctcacctgccagagctgccccgaggtggtgcaggcgctcgatctg
atggccgcgctcaatcctcgcgtcagccatgtcgccatcgacggcgcgctgttcccgcgc
gaggtcgaggagcggcagatcatggcggtgccgagcgtgttcctcaatggcgagccgttc
cagcacggccgcgcgacgctggagcagatcctcgacaagctcgacgccggcgccggcgag
aagcaggccgcgaccctttcggcgaaggcgccctatgacgtgctgatcgtcggcggcggt
ccggcgggcgcggcggcggcggtctatgcggcgcgcaagggcgtgcgcaccggcattgtc
gcggagcgtttcggcggccaggtgcaggacacggcggggatcgagaatttcatttccgtc
ccgcacaccgaaggtcccgagatggcggccgcgctgcagcgtcacgtcgccgaatatggg
gtcgatgtgatgaacggccagatcgccgcggcgctggttccggcgtccgagcccggcgcc
ctcgccgagctgcggctcgtcaatggcgcggtgctgcgatcgaagacgatcgtgctcgcg
ccgggcgcgcgctggcggcgcatcaatgtgccgggcgagaccgaatatatgaccaagggc
gtcgcctattgcccgcattgcgacgggccgctgttcaagggcaagcgcgtcgcggtgatc
ggcggcggcaattccggcgtcgaggcggcgatcgacctcgccggcctcaccgcccatgtg
acgctgatcgaatatgattcgaagctgcgcgccgacggcatattgcaggacaagctgcgc
tcgctgcccaatgtcgagatcatcgtctcggcgcagacgaccgagatccgtggcgacggc
gcgaaagtgaccgggctttcctatcgcgaccgcgagagcggcgacacgcgcgacatcacg
ctcgacggcgtgttcgttcagatcggattgctgccgagcacggaatggctgaagggcgcg
gtgacgctatcgcgcttcggcgagatcgagatcgaccgccgctgcgcgacctcggcgccg
ggcgtgttcgccgcgggcgacgcgacgatcgtgccctataagcagatcgtcatcgccatg
ggcgaaggcgcgaccgcggcgctctccgccttcgatcatctcgtgcggatgtga

DBGET integrated database retrieval system