KEGG   Mycobacterium tuberculosis EAI5: M943_00105Help
Entry
M943_00105        CDS       T02749                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mtx  Mycobacterium tuberculosis EAI5
Brite
KEGG Orthology (KO) [BR:mtx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mtx01001]
    M943_00105
Enzymes [BR:mtx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     M943_00105
Protein kinases [BR:mtx01001]
 Serine/threonine kinases: Other
  Bacterial family
   M943_00105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase RIO1 Kinase-like ABC1
Motif
Other DBs
NCBI-ProteinID: AGQ33601
LinkDB All DBs
Structure
PDB: 

Position
complement(17467..18762)
Genome map
AA seq 431 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRA
EARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPD
LPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSG
TTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVI
KAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTERGETRHSGLQSWVVPPTPHS
RASLARYEIAQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcccccgagttggcgtgacgctgtcgggcagataccgcctgcagcgcctcatcgcc
accggtggtatgggccaagtctgggaggccgtggataaccggttgggccggcgtgttgcg
gtgaaggtgctcaagagcgagttctcctccgatccggagttcatcgaacggttccgggcc
gaagcgcgcaccaccgcgatgctgaaccatccgggcatcgccagcgtgcacgactacggc
gaaagccagatgaacggggagggtcgcacggcctacctggtgatggagctggtcaacggc
gagccactaaattcggtgctcaaacgcaccggccggctgtcgttgcggcacgcactggac
atgctcgagcagaccggccgcgctctgcagatcgcgcatgccgctggcctggtgcaccgc
gacgtcaaaccgggcaacatcttgatcacccccaccgggcaggtgaagatcaccgacttc
ggcatcgccaaagccgtcgatgcagcgcccgtgacccagaccggcatggtgatgggcacc
gcccaatacatcgcgccggagcaggccctcggtcacgacgccagcccggccagcgacgtc
tattcactgggagttgttgggtatgaagcggtttcgggtaaacggccgttcgccggcgat
ggtgccctgaccgtggcaatgaagcacatcaaggagccgccgccgccgctgcctcccgac
ctgccgcccaatgtgcgagaactcatcgagataactctggtgaagaaccccgcgatgcgc
tatcgcagtgggggaccgttcgccgacgcggtggcagcggtgcgcgccggccgccggccc
ccgcggcccagccagacacccccccctggccgggccgccccggcggccattccgtcgggt
acgacagccagggtcgcggccaactctgctggccggactgcggcatcccgtcgatcccgc
ccggccacgggtggtcaccggccgccgcggcgcacgttttcgtccggtcagcgtgcgctg
ctctgggccgcgggggtgctgggggcgctggcaatcatcatcgccgtgctgctcgtcatc
aaagcgcccggggacaacagcccgcagcaggcaccgacgccgaccgtgaccaccaccggg
aaccctccggccagcaacactggcgggactgatgctagcccgcgactcaattggacggaa
cgcggggaaacacgtcattctggactgcaaagctgggttgtcccgccgacaccgcattcg
cgcgcgtcgctggcccgatacgagatagcgcaatga

DBGET integrated database retrieval system