KEGG   Mycobacterium tuberculosis EAI5: M943_04730Help
Entry
M943_04730        CDS       T02749                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtx  Mycobacterium tuberculosis EAI5
Pathway
mtx00071  Fatty acid degradation
mtx00280  Valine, leucine and isoleucine degradation
mtx00281  Geraniol degradation
mtx00310  Lysine degradation
mtx00360  Phenylalanine metabolism
mtx00362  Benzoate degradation
mtx00380  Tryptophan metabolism
mtx00410  beta-Alanine metabolism
mtx00627  Aminobenzoate degradation
mtx00640  Propanoate metabolism
mtx00650  Butanoate metabolism
mtx00903  Limonene and pinene degradation
mtx00930  Caprolactam degradation
mtx01100  Metabolic pathways
mtx01110  Biosynthesis of secondary metabolites
mtx01120  Microbial metabolism in diverse environments
mtx01130  Biosynthesis of antibiotics
mtx01212  Fatty acid metabolism
Module
mtx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    M943_04730
   00650 Butanoate metabolism
    M943_04730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M943_04730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M943_04730
   00310 Lysine degradation
    M943_04730
   00360 Phenylalanine metabolism
    M943_04730
   00380 Tryptophan metabolism
    M943_04730
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M943_04730
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    M943_04730
   00281 Geraniol degradation
    M943_04730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M943_04730
   00627 Aminobenzoate degradation
    M943_04730
   00930 Caprolactam degradation
    M943_04730
Enzymes [BR:mtx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     M943_04730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGQ34399
LinkDB All DBs
Structure
PDB: 

Position
1006857..1007588
Genome map
AA seq 243 aa AA seqDB search
MIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGTAFCAGA
DLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQ
FPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLADAQAW
AAEIARLAPLAIQHAKRVLNDDGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF
QGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtatcacccaggcagaagccgtgctgaccattgagctgcaacgcccggagcgc
cgcaacgccttaaattcccagctggtcgaggagcttacgcaggccatccggaaagccggg
gatggatcggctcgggcgatcgtgctgaccggccaaggcaccgcgttctgcgctggcgcg
gacctgagcggagacgcattcgccgccgattatcccgaccggctcatcgagctgcacaag
gcgatggacgcctccccgatgccagtggtcggcgcgatcaacggtcccgccatcggcgcc
ggcttgcagcttgccatgcaatgcgacctgcgggttgtcgcgcccgatgccttcttccag
tttccgacgtcgaaatacggtctggccctggataactggagcatccgccggctgtcgtcg
ttggttgggcacggacgtgcccgcgcgatgctgctcagcgcggaaaagctgaccgccgag
atcgcactgcacaccggaatggcgaatcgcattggcactttggccgacgcccaggcctgg
gccgccgagatcgccaggctggcaccactggctatccagcacgccaagcgggtgctcaac
gacgacggcgctatcgaggaagcgtggccggcccataaggaactcttcgacaaagcctgg
ggcagccaggatgtcatcgaagcgcaggttgcccggatggaaaagcggccgccgaagttc
caaggggcttaa

DBGET integrated database retrieval system