KEGG   Mycobacterium tuberculosis KZN 605: TBXG_000015Help
Entry
TBXG_000015       CDS       T02141                                 

Definition
(GenBank) transmembrane serine/threonine-protein kinase A pknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Brite
KEGG Orthology (KO) [BR:mtz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mtz01001]
    TBXG_000015
Enzymes [BR:mtz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TBXG_000015
Protein kinases [BR:mtz01001]
 Serine/threonine kinases: Other
  Bacterial family
   TBXG_000015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase RIO1 Kinase-like ABC1
Motif
Other DBs
NCBI-ProteinID: AFM47391
LinkDB All DBs
Structure
PDB: 

Position
complement(17568..18863)
Genome map
AA seq 431 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRA
EARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPD
LPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSG
TTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVI
KAPGDNSPQQAPTPTVTTTGNPPARNTGGTDASPRLNWTERGETRHSGLQSWVVPPTPHS
RASLARYEIAQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcccccgagttggcgtgacgctgtcgggcagataccgcctgcagcgcctcatcgcc
accggtggtatgggccaagtctgggaggccgtggataaccggttgggccggcgtgttgcg
gtgaaggtgctcaagagcgagttctcctccgatccggagttcatcgaacggttccgggcc
gaagcgcgcaccaccgcgatgctgaaccatccgggcatcgccagcgtgcacgactacggc
gaaagccagatgaacggggagggtcgcacggcctacctggtgatggagctggtcaacggc
gagccactaaattcggtgctcaaacgcaccggccggctgtcgttgcggcacgcactggac
atgctcgagcagaccggccgcgctctgcagatcgcgcatgccgctggcctggtgcaccgc
gacgtcaaaccgggcaacatcttgatcacccccaccgggcaggtgaagatcaccgacttc
ggcatcgccaaagccgtcgatgcagcgcccgtgacccagaccggcatggtgatgggcacc
gcccaatacatcgcgccggagcaggccctcggtcacgacgccagcccggccagcgacgtc
tattcactgggagttgttgggtatgaagcggtttcgggtaaacggccgttcgccggcgat
ggtgccctgaccgtggcaatgaagcacatcaaggagccgccgccgccgctgcctcccgac
ctgccgcccaatgtgcgagaactcatcgagataactctggtgaagaaccccgcgatgcgc
tatcgcagtgggggaccgttcgccgacgcggtggcagcggtgcgcgccggccgccggccc
ccgcggcccagccagacacccccccctggccgggccgccccggcggccattccgtcgggt
acgacagccagggtcgcggccaactctgctggccggactgcggcatcccgtcgatcccgc
ccggccacgggtggtcaccggccgccgcggcgcacgttttcgtccggtcagcgtgcgctg
ctctgggccgcgggggtgctgggggcgctggcaatcatcatcgccgtgctgctcgtcatc
aaagcgcccggggacaacagcccgcagcaggcaccgacgccgaccgtgaccaccaccggg
aaccctccggccaggaacactggcgggactgatgctagcccgcgactcaattggacggaa
cgcggggaaacacgtcattctggactgcaaagctgggttgtcccgccgacaccgcattcg
cgcgcgtcgctggcccgatacgagatagcgcaatga

DBGET integrated database retrieval system