KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_0360Help
Entry
MuYL_0360         CDS       T05010                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Brite
Enzymes [BR:muc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MuYL_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASU32263
UniProt: A0A223NQW6
LinkDB All DBs
Position
368550..369158
Genome map
AA seq 202 aa AA seqDB search
MAFTLPALSYATDALEPHIDKLTMEIHHGKHHQAYVTNLNKALEGKPEADGSIDDIIKSI
SKFPPAVRNNGGGHYNHSLFWTLLSPSGGGEPTGALAAAITSTFGSFADFKTKVQEAGAT
RFGSGWAWLIVTADKKLAVTSTPNQDNPLMDIAEVKGTPILGIDVWEHAYYLKYQNRRPD
YLAAIWNVINWNHVAELYARAV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttttacactaccggcgttatcttacgctaccgatgcccttgaaccgcacattgat
aaattaactatggaaattcaccatgggaaacatcaccaggcttatgttaccaacttaaac
aaagcgttggaaggcaaacctgaagccgatggcagcattgatgatattattaaaagcatt
tcgaagttcccgcctgcggtacgcaacaatggcggtggccactataaccacagcttgttc
tggacattgctttcgccaagcggcggcggtgagccaacaggagctttagcagcagcaatt
accagcactttcggttcatttgccgatttcaaaacaaaagtgcaggaagccggtgcaacc
cgttttggttctggctgggcatggttgattgttaccgctgataaaaaattagccgttaca
tcaacaccaaaccaggataaccctttaatggatattgctgaagtaaaaggcacgcctatt
ttaggtattgatgtttgggaacatgcttattatttaaaatatcaaaatcgccgccctgat
tatttggcagctatctggaacgtgatcaattggaaccacgttgctgaattatacgcaaga
gcggtatag

DBGET integrated database retrieval system