KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_0888Help
Entry
MuYL_0888         CDS       T05010                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:muc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MuYL_0888
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:muc03400]
    MuYL_0888
Enzymes [BR:muc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MuYL_0888
DNA repair and recombination proteins [BR:muc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MuYL_0888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2 DNA_ligase_C KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ASU32788
UniProt: A0A223NT14
LinkDB All DBs
Position
complement(959261..961993)
Genome map
AA seq 910 aa AA seqDB search
MSLEKYAEKRDFTKTAEPQAGKSKAKDQLRFVIQKHDASRLHYDFRLEMDGVLKSWAVPK
GPSTDPKTKRLAMMVEDHPYDYRSFEGIIPEGEYGGGTVIVWDEGTYEPVDEIKGKKAQE
KALLTQLKSGSLKIKLHGEKLKGEFALVKTHGMGDNAWLLIKHNDEFASTADITKKDESV
LSGKTIESMEKTGEKIWQHGHEEDVVNIKSKIKKKNPAKAIEEAVGEDTDVSVSDLAGSN
IEQLIKSAPKSAIPKKIKPMLATLVDEPFDDPEWLYEVKWDGYRAMAYINNGEVELLSRN
NKTFSEKFYPIYDLLAKLNVNMVLDGEILVLNEKGISNFSDLQNWRSEADGDLVYYVFDM
LWYQGKNLMDLPLNQRQAILKEVLPENDDRLRVSKVFNASGIDFFNAAERMGLEGIIAKK
ANSVYTPDLRSKDWLKIKVHKRQEVVIAGYTKNADTPKQFSSLLLGVYENEMLQYVGKVG
TGFNDKAQKEMMAQFKPLIIDKSPFEAIPDVNKPSRFRPDPPTAKATWLKPELVCEVAYS
EVTSDGVFRHPSFQGMRVDKKAGEVIRETAKAIEEIIDSTPEKHPDAHSAALKPPKSEGR
KTLLNPKDETQVRKICGHELKFTHLGKVYWPEDKVTKRDMFNYYYQVAEYMLPYLKDRPM
SLNRFPNGIHGPSFYQKDVKDKAPDWAKTFPYTNGEGEHKEYLVATDEASLLWMVSLGCI
EINPWFSRIQSPDNPDYCVIDLDPDKNTFDQVIAAAQEVKKVLDAIDVPSFCKTSGSTGM
HIYIPTDAKYDYDQTQMFARIIVNIVNKQLPDYTSLERMVAARKGKMYLDFLQNRPGATI
AGPYSLRPKVGATVSMPLHWDEVRAGLKMTDFTIFNTIDRLKETGDLFKGVLGNGIDLEL
TIKKAKATFG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggaaaaatatgcagaaaaacgagactttactaaaactgcggagcctcaagct
ggcaaaagcaaggcaaaggatcagctgaggtttgtgattcaaaagcacgacgcatcacgg
ttgcactatgatttcaggcttgaaatggatggtgtattaaaaagctgggcggttcctaaa
ggtccgtccacagatcctaaaacaaagcgcctggccatgatggttgaagatcacccgtat
gactaccgcagctttgaaggtattattcccgaaggtgagtacggtggcggcaccgttatt
gtttgggacgagggaacttatgagcctgtagatgagattaaaggaaaaaaggctcaggaa
aaagcgttgttaacccagctaaagtcaggctcgttaaaaatcaagcttcacggcgaaaaa
cttaaaggggagtttgcgctggtaaaaacacacggcatgggagataatgcctggctgctg
ataaagcataacgacgaatttgcttctactgcagacatcactaaaaaggatgaatccgtg
ctgtcgggaaagaccatcgaaagcatggaaaaaaccggtgaaaagatttggcaacacggc
catgaagaagatgtagtgaacataaaatcaaaaattaaaaaaaagaatccggcaaaggca
attgaggaggctgtgggtgaagacaccgatgtatcagtttcggatttggccgggtcgaat
attgaacagctgataaaatctgcaccaaaatcagctatccccaaaaaaataaagcccatg
ctggctaccctggttgacgagccttttgatgaccccgagtggctatatgaagtaaaatgg
gacggctatcgcgcaatggcttatattaataatggcgaggttgagctgctctcgcgaaat
aacaaaaccttcagcgaaaaattttatcccatatacgacctgctggcaaaactgaacgtt
aatatggttttggatggcgagatactggtgcttaacgaaaaagggatctccaatttcagc
gaccttcaaaactggcggagcgaggccgatggcgacctggtttattatgtatttgacatg
ctttggtaccagggtaaaaacctgatggacttaccgctaaaccagcgccaggccatatta
aaagaagtgctgccggaaaatgacgaccgtttgcgggtgagcaaagtatttaatgccagc
ggcatagatttttttaacgcagcagagcgaatgggactggaggggattatcgcaaaaaaa
gcgaacagcgtttatacgcctgatctccgctccaaagattggttgaaaataaaagtccat
aaaaggcaggaagtagttattgccggttacaccaaaaatgcagacaccccaaagcaattt
agctcgttgttgctgggtgtttacgaaaatgagatgttgcaatatgttggtaaagtcggc
accggatttaatgataaggcgcaaaaagaaatgatggcacaatttaagccgctgataatt
gataagagtccttttgaagctattccggacgtaaacaagccttcacgatttcggcccgat
ccgccaacagcaaaggccacctggctgaagcccgaactggtgtgcgaagtagcttacagc
gaagtaacaagcgatggtgtatttagacacccctctttccagggaatgcgggtagataaa
aaagctggagaagtgattagggaaactgcaaaagctatagaagaaattatagattcgaca
ccagagaaacaccccgacgcccattccgctgcattaaaaccgccgaagagcgaaggacgc
aagactttgttaaaccctaaagatgaaacgcaggtgcgcaaaatttgtgggcacgagctg
aaatttacgcaccttggcaaggtttactggccggaggacaaggtaaccaaaagagatatg
tttaattactattaccaggttgctgagtatatgttgccttatttaaaagaccggccaatg
tcgcttaacaggtttcccaatggcattcacgggcccagcttttatcaaaaagacgtaaaa
gacaaagcgcccgattgggcgaaaacatttccatacaccaacggtgagggtgaacataaa
gaatacctggttgccaccgacgaggcaagcctgctttggatggtatccttagggtgtatt
gagataaacccatggttcagcaggatccaatcgcctgataaccccgactattgtgtgata
gacctcgaccccgataaaaacacgttcgaccaagtgatagcggcggcacaggaagtaaaa
aaggtacttgatgcaatagatgttccctctttctgtaaaacatcaggttcaacaggtatg
catatttatatacccacggatgcgaaatatgattatgatcaaacacaaatgtttgcccgc
attatagtgaatattgtgaataaacagttacctgattacaccagcctggaaagaatggtt
gctgcacgtaaaggaaagatgtacctcgactttttacaaaaccgccccggcgctactatt
gcaggcccctattccctacgcccaaaagtgggtgcaaccgtatcaatgcccctgcattgg
gacgaagtaagggcaggccttaaaatgacagattttaccatttttaacacaattgataga
cttaaggaaaccggtgacctttttaaaggggtgctgggtaacggtattgatctggagctg
accatcaagaaagccaaagccacatttggctga

DBGET integrated database retrieval system