KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_2164Help
Entry
MuYL_2164         CDS       T05010                                 

Definition
(GenBank) cystathionine gamma-lyase/cystathionine beta-lyase
Organism
muc  Mucilaginibacter sp. BJC16-A31
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Met_gamma_lyase Aminotran_5 DegT_DnrJ_EryC1 Spore_YtrH Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ASU34054
UniProt: A0A223NWH4
LinkDB All DBs
Position
2327322..2328461
Genome map
AA seq 379 aa AA seqDB search
MKFATKAIHAGQEPDPTTGAVMTPIYQTSTYWQKSPGDNKGYEYSRGTNPTRKALENCLA
ALENAQFGLAFSSGMGATDAVMKLLKPGDEVITGNDLYGGSYRMFTKIFANYGIKFHFLN
LSDPEIIREYANENTKLIWIETPTNPTMQIVDIAAVAAISKEKNILLTVDNTFASPYLQN
PIDLGADIVMHSVTKYIGGHSDVVMGALMLNDEELYKRLWFIYNACGATPGPMDSFLVLR
GIKTLHLRMKAHCENGRIIAEFLKTHPKVEKIYWPGFKDHPNHDVAKKQMRDFGGMISIV
LKDADLQETFRIASSFKVFALAESLGGVESLINHPVSMTHGSIPKEEREKVGVVDNLLRL
SVGVEDVDDLLEDLKQALV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgcaacaaaagccatacacgcaggacaagagcctgaccccacaacaggggcg
gtgatgacaccaatataccaaacatcaacctactggcagaaatcgccgggagacaataaa
ggttatgagtactcgcgtggtaccaatccaacccgcaaggcgctggagaattgtttggca
gcgctggaaaatgcacaattcggcctggctttttcgagcggaatgggcgctacggatgcc
gtgatgaaattgttaaagcctggcgatgaagttatcacagggaatgatctttatggtggg
tcataccggatgttcaccaagatctttgctaattatggcattaagtttcattttttgaac
ctttctgacccggagatcatcagggaatatgccaatgaaaatacgaagctgatctggatt
gaaaccccaaccaacccaaccatgcagattgttgatattgcggcagttgccgcaatcagc
aaagaaaagaacatcctgctgacggttgataacacttttgcatcgccatacctgcaaaac
cctatcgaccttggtgcggacattgtaatgcactccgttaccaagtatataggtggccac
agcgacgtagtgatgggggctttgatgctgaatgatgaggagttatataaaaggctttgg
tttatttataatgcctgcggcgccacacccggcccgatggatagctttttagtgctgcgc
ggaattaaaaccctgcacctgcgaatgaaagctcattgcgagaatggccgtataatagct
gaattcttaaaaacgcaccctaaagtagagaagatctactggcccggatttaaagaccat
ccaaatcacgatgtcgccaaaaaacaaatgcgcgattttggcggaatgatctccattgtg
cttaaagatgccgatctgcaggaaactttccggattgcatcatcatttaaagtatttgca
ctggcagaatcactgggcggtgttgaatcactgatcaatcacccggtaagtatgacgcat
ggctcgatcccaaaagaagaacgggaaaaagttggtgtggttgataacctcctgcgttta
agcgtaggagtagaggatgtggatgatttgctggaggatttgaaacaagcgctggtttaa

DBGET integrated database retrieval system