KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_2760Help
Entry
MuYL_2760         CDS       T05010                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00380  Tryptophan metabolism
muc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:muc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MuYL_2760
Enzymes [BR:muc01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     MuYL_2760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ASU34647
UniProt: A0A223NXP7
LinkDB All DBs
Position
complement(2935195..2936472)
Genome map
AA seq 425 aa AA seqDB search
MIFQNTSQFADLLDEQDPLKNFRSKFLVPQHKGKDTLYFCGNSLGLQPVTAQHNINGILQ
TWQNLAIEGFFAGEDPWLGYHKKLTHTLSSIVGAKSEEVTIMNSLTVNLHLLMVSFYKPT
GKRYKIIMEGSAFPSDQYALASQVKFHGYDPKDSIIEIFPRDGEFTLRTEDILEVIDQHA
SDLALVLFGGINYYTGQCFDMLSITAAAHKAGAYAGFDLAHAAGNVVLKLHDWDVDFACW
CAYKYMNSGPGGISGIFVNEKHFANPYLSRFEGWWGFKQDERFLMPHDFKPEVGAAGWQL
STSPVVLLALHKAALDIFEEAGGIEPLRIKSELLTAYLEFLINDINTNNNDELFRIITPK
NKVERGCQLSLVCKKNARQTFNFLMENGVMGDWREPNVIRLSPVPLYNSFMQVFELGQIL
AAAVV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgatttttcagaacacttcacaatttgccgacttgctcgatgaacaggatccgttaaaa
aacttccggtcaaagttcctggtgccacagcataaaggaaaagatacgttgtacttttgt
ggtaactcattgggcttacagccggtaacagctcagcacaacataaatggaatattacag
acctggcaaaaccttgctattgaaggtttttttgcgggggaagatccttggctgggttat
cacaaaaaattaacacatacgctttcgtcaattgtgggtgctaaaagtgaagaggttacc
attatgaactctcttacagtaaatcttcatttactgatggtaagtttctataaaccaaca
ggtaaaaggtataaaataatcatggaaggcagtgcgtttccctcagatcaatatgcactg
gcaagccaggtaaagttccacggatatgatccaaaagactcaattatcgaaatctttccg
cgcgatggtgaatttacgctacgtacggaagatatcctggaagttatagatcagcatgcg
tctgacctcgcactggtactgtttggcggtataaattattatacaggccagtgttttgac
atgctgtcaataaccgcggcagcgcataaagctggcgcttatgccggctttgatcttgcc
catgctgcaggtaatgtagttttaaagctgcatgattgggatgttgattttgcctgctgg
tgcgcttataagtatatgaattcaggcccgggtgggattagcgggatttttgttaatgaa
aaacactttgctaacccctatttaagccggtttgaaggatggtggggatttaaacaggac
gaacgttttttaatgccgcatgatttcaaaccggaagttggtgcggctgggtggcagtta
agtaccagcccggttgtgttattagcccttcataaggccgccctggacatttttgaagag
gcgggcggcattgagccgctccgcataaaaagtgagctcctaaccgcttatttggagttt
ttaatcaacgatatcaacacaaataataatgatgagttatttaggatcatcactccgaaa
aataaagttgaacgcggctgccagctttctctggtctgcaagaaaaatgccaggcaaacc
tttaattttttaatggaaaacggcgtaatgggcgattggcgggaaccaaacgtaattcgt
ttaagtccggtaccgctttataatagcttcatgcaggtttttgaacttggacagatacta
gctgccgctgtggtttaa

DBGET integrated database retrieval system