KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_2814Help
Entry
MuYL_2814         CDS       T05010                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00564  Glycerophospholipid metabolism
muc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:muc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MuYL_2814
Enzymes [BR:muc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MuYL_2814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like NAD_binding_8 Pyr_redox_2 Thi4 Pyr_redox_3 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ASU34701
UniProt: A0A223NYR4
LinkDB All DBs
Position
complement(2987758..2989332)
Genome map
AA seq 524 aa AA seqDB search
MVNTGREKLVNAITDPEKVWDIIVVGGGATGLGTALDAASRGYQTLLLEQADFAKGTSSR
STKLVHGGVRYLAQGDIGLVREALYERGLLLKNAAHLVKNESFIIPNYEWWSGAFYTIGL
TIYDLLAGKLSFGRSKHISKKETISRLPGVIEKGLYGGVVYHDGQFDDSRLAINLAQTCL
EQGATVLNYFKVQDLLKAGDKICGVTAKDEESGRIYQLKGKVVINATGVFVDDLLQKDEP
HKKPLVKASQGIHIVVDKQFMAGDDAIMIPKTEDGRVLFVVPWHGKLLIGTTDTPLNEHR
LEPIALEEEIDFVMRTAGKYLIKPPLRQDVRSVFAGLRPLAAPQEGSAKTKEISRSHKLI
VSASGLVTITGGKWTTYRRMAQDTVDKAIVVAKLQPHATVTRNMAIHGNKTDVDRDDHLY
VYGSDREALLALMVEQPEWAELLHPRLEYTKAEVIWAVRHEMARKLEDVLARRLRALFLD
ALAAIDMAPTVAHLMALELNKDEDWEKAQVVDFNMMAQGYLLKD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtggttaataccggacgtgaaaaattagtcaatgctattaccgatcctgaaaaggtttgg
gacataattgtggtaggcggtggcgctactggcctgggcaccgcgcttgacgctgcatcg
cgcgggtatcaaaccttactgcttgaacaggcagattttgctaagggaacttccagccgc
agcacaaaactggttcatggcggtgtacgttatcttgcacagggcgatattggcctggta
agggaagcgctgtacgaacgcggattacttttaaaaaatgcagcacacctggttaaaaat
gaatcgttcattatccctaattacgagtggtggagcggcgctttttataccatcggttta
acaatttacgatttgctggccggaaagcttagtttcggcaggtcaaaacacatttcaaaa
aaagagactatcagtcggcttcccggtgttattgaaaaaggtttgtatggtggtgtagta
tatcatgacggacaatttgatgactcgcggcttgctataaaccttgcgcaaacctgcctg
gaacagggcgcaacggtattaaactattttaaggtgcaggatttgcttaaagccggcgat
aaaatatgtggcgttacagccaaagatgaagaatcaggcagaatttatcagttaaaaggc
aaggttgtaattaacgctacaggtgtgtttgttgacgatttactgcagaaagatgagcca
cataaaaagccgctggttaaagcgagccagggcattcacattgtggtagataagcaattt
atggctggtgatgatgccataatgatccctaaaacggaggatggcagggtactttttgtg
gtgccgtggcatggaaaactgttgattggcactacagataccccattaaatgagcaccgg
cttgaaccgatagcattggaagaggaaattgatttcgtaatgcgtacagccggcaaatat
ttaataaaaccacctttaagacaagacgtccgcagtgtatttgcaggattgcggccactg
gccgcaccgcaggaaggatcagccaaaacaaaagagatttcacgcagccataagctcatt
gtttctgcatcggggctggttaccataaccggcggtaaatggacaacctaccgccgcatg
gcgcaggatacggttgataaagccatagtggttgctaaactgcagccccatgcgactgta
acgaggaatatggccatccacggcaataaaacagatgttgatcgagatgatcacctatat
gtttatggaagtgacagggaagctttattggctttgatggttgagcaaccggaatgggct
gaattgctgcatccccggctggaatacaccaaagctgaggtaatatgggcggtaaggcac
gaaatggcgcgtaaattagaagatgtgcttgcccgcaggttaagagcacttttccttgac
gcactggccgccattgatatggcaccaaccgttgcgcacctgatggctttagagcttaat
aaagacgaagattgggaaaaagcccaggttgtcgattttaatatgatggcacagggatat
ttactaaaagactaa

DBGET integrated database retrieval system