KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_3083Help
Entry
MuYL_3083         CDS       T05010                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00473  D-Alanine metabolism
muc01100  Metabolic pathways
muc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:muc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MuYL_3083
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MuYL_3083
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:muc01011]
    MuYL_3083
Enzymes [BR:muc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MuYL_3083
Peptidoglycan biosynthesis and degradation proteins [BR:muc01011]
 Precursor biosynthesis
  Racemase
   MuYL_3083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ASU34968
UniProt: A0A223NZG1
LinkDB All DBs
Position
3285416..3287878
Genome map
AA seq 820 aa AA seqDB search
MLSNQYTIIAIQQIINAGGNIVKDYNISTLLTDSRRISNPAGGLFFALSGRRNGHEFIAE
AYAGGVRNFVVKHGTDIKAPESNFLMVDDVLAALQTLAAYHRNRFNLEVIGITGSNGKTI
VKEWLYQLLSPDKNVVRNPKSYNSQIGVPLSVWQINEKNDLGIFEAGISTVGEIEKLEAV
IRPTVGILTHIGPAHDEGFENRNQKITEKLKLFKNCRLLIHNYDQLISFQDNIPVESRFT
WSTNFKQADLYVFSEAVVSKNYYLRARYKDAEIECLIPFLDEASVENAIVCWATMLALGY
APAEADDRIERLNAVSMRLELKTGINDCSVIDDSYNSDIQSLEIALNFLTQQNQHQKKTL
ILSDIYQSGLQADVLYRQVADMIKIKQVDKFIGVGEALMARQDYFDMPEKFFYPDTQAML
QHLRTLNFKGETILIKGSRSFEFERISRALVQKAHETILEINLNALLNNLNFYRSRLKQG
VKVMAIVKAFSYGSGTFEVANILQYNKVDYLAVAYIDEGVSLRNTGISLPVMIFNPEASA
FDKLIEFNLEPVIYSFGLLDEFITYAQEKNVLNYPVHLKIDTGMHRLGFEDFEIETLCDL
LEANRYIRVQSVFSHLVASEAAKHDKFTKKQISNFETAYKQIELTLGYKVIKHISNTSGI
TRWPGAHYDMVRLGIGLYGIDTGMETPDTGLQPVATLKTSVAQVKKIKAGETLSYSRSGS
LTKDGKIATVRIGYADGYLRAFGNGVGKMLVKGVLAPTVGNITMDMCMIDVTGIDVKEGD
EVIIFNEQQRINDLATQIGTIPYEILTNVSQRVKRVYFYE
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgctcagcaatcaatataccataatagctatacagcagatcatcaatgccggcgggaat
attgttaaagattacaatatcagcaccttattaaccgacagccgcaggatcagcaatcct
gcaggcggtttgttctttgcgctgagcggccggcgcaacggccacgagtttattgcggaa
gcttatgcaggcggtgtccgcaattttgtggtaaaacacggaaccgacattaaagcgccc
gaatcaaactttttaatggttgacgatgtactggccgcgttgcaaacgctggctgcttat
caccgtaaccgttttaacctcgaagtaataggaataaccggcagcaacggcaaaaccatt
gtaaaagagtggctgtaccaactgctgtcgcccgataaaaatgtggtacgtaaccccaag
agctataactcgcaaatcggagtgccgctttcggtttggcaaatcaacgaaaaaaacgac
ctgggtatttttgaagcaggcatctctacagttggtgaaatagaaaagctggaagccgtg
atcaggcccactgttggcattttaacacacattggccctgcgcatgatgaaggatttgag
aaccgcaaccagaagattacggagaagctgaagctatttaaaaactgccgcttgctaatc
cataattatgaccagctgatcagtttccaggataacatcccggttgaaagccgctttacc
tggagcaccaattttaaacaggccgacctgtacgtgttcagcgaggcggtggtatcaaaa
aactattatttaagggcaaggtataaagacgcggaaattgaatgcctgatcccatttttg
gatgaggcatcggtagagaatgctattgtttgctgggctaccatgctggccctgggctac
gcccctgccgaagctgacgaccggatagaacgtttaaacgccgtaagcatgcggctggaa
ctaaaaaccggtatcaatgattgctccgttattgacgactcttacaattcggacatccaa
tcgctggaaatagccttgaactttttaacgcagcaaaatcaacatcaaaaaaagacactc
attctttctgatatttaccagtcgggcttgcaggctgacgtgctgtacaggcaggttgcc
gatatgataaaaataaaacaggtggacaaatttatcggcgtgggcgaagcattgatggcc
cgacaggactactttgacatgcccgaaaagttcttttacccggatacccaggccatgctg
cagcacctgcgcaccttaaattttaagggggaaaccatactgataaagggttcgcgcagt
tttgagtttgaacggatcagccgcgcgctggttcaaaaggcacatgaaaccatattggag
ataaacttgaatgcgttactaaacaaccttaatttttaccggtcgcggttaaagcagggt
gtaaaagtaatggccattgtaaaagcattttcatacggcagcggcacctttgaagtagcc
aatatcctccagtacaacaaggttgactaccttgctgttgcctacatagacgaaggggta
tccctgcgcaacacaggcatcagcctgcccgtaatgatctttaaccctgaagcctctgca
tttgacaagctcatagaatttaacctggaacctgttatttacagctttgggttactggac
gaatttattacctacgcacaggaaaaaaatgtattgaactaccctgttcaccttaaaatt
gataccggtatgcaccgccttggctttgaggactttgaaattgaaaccctttgcgacctg
ctggaagctaaccggtacatcagggtgcagtcggtgttttcgcacctggtggccagcgaa
gccgcaaagcacgacaagtttaccaaaaagcagatcagtaattttgaaactgcttacaaa
caaatagagcttacccttggctacaaggtgatcaagcacatcagcaatacctcaggtatt
accaggtggcccggcgcgcattatgacatggtgcgcctcggaattggcttatacggcatt
gataccggtatggaaacccccgacaccggcttacagcctgtggccaccttaaaaaccagc
gttgcgcaggtaaaaaaaatcaaagccggagagaccctcagctacagccgtagtggcagt
ctgacaaaagacggcaaaatagctaccgtacggattggctatgccgacggctatttgcgt
gcctttggcaacggcgttggcaaaatgctggtgaaaggagttttggcgcccaccgtgggt
aacataaccatggatatgtgtatgattgatgttaccggcatcgatgtaaaggaaggcgac
gaggtaattatatttaacgagcagcagcgcattaacgaccttgcaacccaaattggcacc
ataccttacgaaatattaactaatgtttcgcaaagggttaaaagggtgtacttttatgaa
tag

DBGET integrated database retrieval system