KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_3789Help
Entry
MuYL_3789         CDS       T05010                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00240  Pyrimidine metabolism
muc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:muc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MuYL_3789
Enzymes [BR:muc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MuYL_3789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ASU35674
UniProt: A0A223P160
LinkDB All DBs
Position
complement(4023793..4024374)
Genome map
AA seq 193 aa AA seqDB search
MVFVEDIFKRRNELGGSIEVVCGSMFSGKTEELIRRLNRAKIARLKVEIFSPKADTRYDE
NALVSHNATSIPSTPVENASSILLLASDVHVIGIDEAQFFDEELPDVCNILANKGIRVIV
AGLDMDFKGRPFGPMPAIMAMAESVTKLHAVCVRCGNPALYSYRLLPDENQVMLGEKESY
EPRCRSCYTNLEV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttggtgtttgtagaagatatatttaagcggagaaatgaactggggggcagtatagaagtg
gtttgcggatcgatgttttcaggcaaaacagaggagctgatccgccggcttaacagggcg
aagatagcccgattaaaagtagagatctttagtccgaaggccgatacccggtatgatgaa
aatgctttggtttcgcacaatgcaacctctattccttcaacccctgttgagaacgcgtca
tccatattattgctggccagtgatgtgcacgtgatagggattgatgaagcgcagtttttt
gatgaagagctgcctgatgtgtgtaatatcctcgccaataaaggtatccgtgtaattgtt
gccgggttggatatggatttcaagggccgtccgtttggcccgatgcccgccattatggct
atggccgaatcagtaaccaaactgcatgctgtatgcgtgcgctgcgggaaccctgcctta
tactcgtaccgcctgctgcccgatgaaaaccaggtaatgctgggcgaaaaggaaagctac
gaaccccgctgccggagctgctacactaatttggaggtgtaa

DBGET integrated database retrieval system