KEGG   Mucilaginibacter sp. HYN0043: HYN43_000170Help
Entry
HYN43_000170      CDS       T05668                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00061  Fatty acid biosynthesis
muh00780  Biotin metabolism
muh01100  Metabolic pathways
muh01130  Biosynthesis of antibiotics
muh01212  Fatty acid metabolism
Module
muh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HYN43_000170
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HYN43_000170
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HYN43_000170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:muh01004]
    HYN43_000170
Enzymes [BR:muh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HYN43_000170
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HYN43_000170
Lipid biosynthesis proteins [BR:muh01004]
 Fatty acid synthase
  Component type
   HYN43_000170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AYL93804
UniProt: A0A494VI75
LinkDB All DBs
Position
complement(34698..35510)
Genome map
AA seq 270 aa AA seqDB search
MAYNLLKGKKGIIFGALNEQSIAWKVAQRAVQEGAEIVLSNAPIALRMGELNKLAEECNA
PVIGADVTNGDDINNLFTKTLEHFGGKVDFILHSIGMSVNVRKNIPYYENNYDFTHKGFD
ISALSLHRILQAAMKHDAINEWGSVVALSYIAAQRYFPGYNDMADNKAVLESIARNFGYE
YGMAKKVRVNTISQSPTRTTAGSGVKGFDGFIEFAEKMSPLGNADADQCADYCVSLFSDL
TKMVTMQNLFHDGGFSFTGVTQAVIDQMGK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcttataatttattaaaaggtaaaaaaggcatcattttcggtgcgctaaatgagcaa
tcaatagcctggaaggtagcacaacgtgccgtacaggaaggtgctgaaattgtattatca
aacgcccctatcgctttacgcatgggcgaactcaataaactggccgaagaatgtaacgcg
ccggttattggtgccgatgttaccaatggcgatgacattaacaacctgttcaccaaaacg
cttgagcattttggcggtaaagttgatttcatcctgcactcgataggtatgagcgttaac
gtgcgcaaaaacatcccttactacgaaaacaactacgattttacccacaaaggtttcgat
atatctgcattaagccttcaccgcattttacaggcggccatgaagcatgatgccattaac
gaatggggttcggtagtagcattaagctatatcgctgctcaacgttatttccctggctat
aatgatatggccgataacaaagctgtattagaaagcattgcccgtaactttggttacgaa
tacggtatggctaaaaaagtgcgtgttaacaccatttctcaatcaccaacccgcaccact
gcaggatctggtgtaaaaggctttgatggctttattgagttcgccgagaaaatgagcccg
cttggtaatgccgatgcagatcagtgtgctgattactgcgtaagcttgttcagcgatctg
actaaaatggttactatgcaaaacctgtttcatgatggaggcttctcgttcactggcgta
acccaggcggttattgaccagatgggtaagtaa

DBGET integrated database retrieval system