KEGG   Mucilaginibacter sp. HYN0043: HYN43_006260Help
Entry
HYN43_006260      CDS       T05668                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00564  Glycerophospholipid metabolism
muh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HYN43_006260
Enzymes [BR:muh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HYN43_006260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 GIDA Pyr_redox_3 Pyr_redox_2 Thi4 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AYL94925
LinkDB All DBs
Position
complement(1568678..1570258)
Genome map
AA seq 526 aa AA seqDB search
MNLFNRESNLAVLANPSKIWDLIIIGGGATGLGAAVDAASRGFSVVLLEQADFAKGTSSR
ATKLVHGGVRYLAQGDIGLVREALRERGLLLKNAPHLVKNESFIIPNYSWWGGIFYTIGL
SIYDILAGKLSFGHTKHISKKQILKRLPGLQQKGLRGGVVYHDGQFDDSRLAINLAQTAV
EQGAVMLNYFKVTGLFKDSGGKISGVTATDLESNQPYQLKAKAIVNATGVFVDEILKMDA
PEKQAMVRPSQGVHLVLDHSFLPGEDALMIPKTEDGRVLFAVPWHGKLLVGTTDTLIDEH
SLEPVALDQEIEFILRTAAQYLTKQPKREDVLSVFAGLRPLAAPQNGSSKTKEISRSHKL
IVSGSGLITITGGKWTTYRKMAEDLVDKAIQTAGLQPVACKTASLPVHGSRENPDWNDPM
YVYGSDTENILALYDENSDWKAAVHPNSLYTKAEVIWSVRYEMARTVEDILARRTRVLFL
DARLAVAMAPEVARLMAIELKRDEIWQNQQLEAFNKTAKNYILTSH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaacctatttaatagagaaagtaacctggccgttttagccaatccaagcaaaatctgg
gacctgattattataggcggcggggcaaccgggcttggtgccgccgttgatgcggcctca
agaggcttctctgttgtattgttagaacaggccgactttgccaaaggcacttccagccgg
gcaaccaaactggttcatggcggagtacgctatttggcccaaggtgatatcggcctggtg
cgcgaagctttgcgtgaacgcgggttattgcttaaaaacgcacctcacctggtaaaaaac
gaaagttttattatccctaattatagttggtggggagggatattttacactatcggccta
agcatttacgatattctggccggcaaactgagctttgggcataccaaacacatctccaaa
aaacaaatactgaagcgtttgcccggcttgcagcaaaaaggcctgcgcggaggcgttgtt
taccacgatgggcagtttgatgattcgcggctggctatcaatcttgctcaaactgctgtt
gaacagggcgctgtgatgcttaactattttaaagtaaccggcttgtttaaagatagcggc
ggcaaaatatcgggcgttacagctaccgatctggaaagcaatcaaccttaccagcttaaa
gccaaagctattgttaatgccacaggggtatttgttgatgagattcttaaaatggatgcg
ccagaaaaacaggcaatggtgcggccaagccagggtgtgcacctggtactggatcattcc
tttttgccgggcgaggacgcgctgatgattcccaaaaccgaagatggacgcgtactgttt
gcagtaccctggcatggtaaattactggtaggaacaaccgataccctgattgatgaacac
agccttgaaccggtagctctggatcaggaaatcgaatttattttacgtaccgcagcacag
tatctaaccaaacaaccaaaacgcgaagatgtgcttagtgtgtttgccggcttaaggccg
ctcgctgcgccgcaaaacggatcatcaaaaaccaaagaaatatcaagaagccataagtta
atagtatccggttcgggtttaatcaccataaccggcggtaaatggactacctatcgcaaa
atggccgaggatcttgttgacaaggccattcaaaccgcgggattacaacccgtagcctgt
aaaaccgcatcgttaccggtacatggcagcagggaaaacccagattggaatgatcccatg
tatgtttacggaagcgatactgaaaatatcctggcgttgtatgatgaaaactctgattgg
aaagctgcggttcatccgaatagcctgtataccaaagccgaagtgatctggtcggttagg
tacgaaatggcgcgtacggtggaagacatccttgcccgtcgcacccgcgttttgttttta
gatgcccgcctggcggtggctatggctcctgaagttgcgcgcttaatggctattgagctt
aagcgtgacgaaatatggcaaaaccaacagcttgaggcttttaataaaactgcaaaaaat
tatatccttacatcacattga

DBGET integrated database retrieval system