KEGG   Mucilaginibacter sp. HYN0043: HYN43_009405Help
Entry
HYN43_009405      CDS       T05668                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00380  Tryptophan metabolism
muh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    HYN43_009405 (kynU)
Enzymes [BR:muh01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     HYN43_009405 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AYL95496
LinkDB All DBs
Position
complement(2360883..2362166)
Genome map
AA seq 427 aa AA seqDB search
MNYQNNLEFAKQQDQLDPLKNFRNQFLIPRHKGEDVVYLCGNSLGLQPITAQQYLNDQLN
NWKNLAVEGWFQGDDPWLDYHKSLSGSIARIVGAQENEVAVMNSLTVNLHLLMVSFYKPD
NKRFKIIMEGGAFPSDQYAMESQVKYHGFDPKDAIIEIFPREGEFTLRTEDIISTIHQNQ
NELALVLFGGINYYTGQFFDLKAITDAAHQAGAYSGFDLAHAAGNVPLKLHEWGADFACW
CSYKYMNSGPGGISGIFVHEKHFTDGQLNRFAGWWGYRQDNRFLMAPGFDPAHGANGWQV
STSPILLLALFKASMAIFDTAGDISILRRKSESLTGYLEFLINDINTNQNEEVFKIITPA
APETRGCQLSVVCKRNAKATFNFLAENGVIGDWREPDVIRLSPVPLYNTFEDVYKTAALL
ATSITTL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaaaataatttagagtttgccaaacagcaggatcaactcgatccgcttaaa
aatttcaggaatcagtttcttatcccccggcataaaggcgaagacgtggtttatctctgc
ggaaattcgctcgggttacaacccattactgcgcaacagtacttaaatgaccagttgaac
aattggaaaaaccttgctgttgaaggctggtttcagggagatgatccctggctggattac
cacaaatcactttcgggttcgatagccagaattgttggcgcgcaggaaaacgaggttgct
gtaatgaattcacttacagtaaaccttcatttactgatggtaagcttttataaaccagat
aacaaaagatttaaaattatcatggagggaggcgcttttccctcagatcaatatgccatg
gagagccaggtgaagtaccacggcttcgatcctaaggatgcgataattgagatttttcca
cgggaaggcgagtttacattacgcacggaagatatcatcagcacaatccaccaaaaccaa
aatgaactggctttggtactgtttggcggaattaattattacaccggtcagttttttgat
ctgaaagccataaccgacgccgcacaccaggccggagcttattcaggttttgatttggcc
catgcagcgggcaatgtgccgctaaaacttcacgaatggggtgccgattttgcctgctgg
tgctcgtacaagtacatgaattcgggccccggcggcatcagcggtatttttgtacacgaa
aagcatttcaccgatgggcagcttaatcgctttgcaggctggtggggataccggcaggat
aatcgttttttgatggctcccggcttcgatcctgctcatggtgccaatggctggcaggta
agcaccagtcctattttgcttttggcgctatttaaagcctctatggcgatttttgatacc
gcgggcgatataagtatcctccgaagaaaaagcgagtctctaacgggctatttggagttt
ttaataaatgatattaatacaaaccaaaacgaggaagttttcaagattatcactcctgcc
gctccggaaacccgtggctgccagctctcggtggtttgcaagcggaacgcaaaggctact
tttaactttcttgccgaaaatggcgtgataggagactggcgcgaacccgatgttatccgc
ttaagcccggtgccgctgtacaatactttcgaagatgtttacaagacggctgcgttatta
gccacttcaattactactttataa

DBGET integrated database retrieval system