KEGG   Mucilaginibacter sp. HYN0043: HYN43_009535Help
Entry
HYN43_009535      CDS       T05668                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00473  D-Alanine metabolism
muh00550  Peptidoglycan biosynthesis
muh01100  Metabolic pathways
muh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HYN43_009535
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HYN43_009535
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HYN43_009535
Enzymes [BR:muh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HYN43_009535
Peptidoglycan biosynthesis and degradation proteins [BR:muh01011]
 Precursor biosynthesis
  Amino acid ligase
   HYN43_009535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: AYL99391
UniProt: A0A494VZ32
LinkDB All DBs
Position
complement(2385392..2386375)
Genome map
AA seq 327 aa AA seqDB search
MKNIALLAGGYTGEYEVSVNSAKNIAANLCGNANYKIYAIFITRDRWFFEADDTKVDVDK
NDFSITLNQEKIKFDFAFITIHGTPGEDGKLQGYFDMLGIPYNTCDATTSAITMNKAYTK
AIVNGIHGLHTAHSMRLFERDVHDVATIAANLKFPFFIKPNNGGSSVGMSKVQNIAGLPE
ALNRAFQEDSQVLVEEFIKGREFSIGIARLHGKIRVLPATEIITSKDFFDYEAKYTDGVT
KEITPADLPAEKVEQIGEIVTEAYIRLNCRGMARVDFILQESTNDFYFIEINTTPGQSAA
SLIPQQVRAAGMDVGEFYSALIEGAGL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atcaaaaatattgcccttttggccggaggttataccggcgagtatgaagtatcagtaaac
agtgcaaaaaatattgccgccaacctgtgcggtaacgccaattacaagatttatgctatt
tttataacccgcgacaggtggttttttgaggcagatgacacgaaggtagatgttgataaa
aatgatttcagcatcaccctgaatcaggaaaaaataaagtttgattttgcctttatcact
attcacggtacgccgggcgaagatgggaagttgcaggggtattttgatatgctgggcatc
ccttataatacctgcgatgccaccacatcggccattaccatgaataaggcctacactaag
gctattgtaaacggtattcacggtttacacaccgcgcactctatgaggttatttgagcgt
gatgtacatgatgtggcaaccatagctgccaaccttaaattcccattttttataaagcct
aacaatggcggcagcagtgtaggcatgagtaaggtacaaaacatagccggcttgcccgaa
gctttaaacagggcttttcaggaagacagccaggtgttggttgaagagtttataaaaggc
cgcgagtttagcattggtattgcccgcctgcacggcaaaataagagtactgcctgccacc
gaaatcatcacctcgaaagacttttttgactacgaagccaagtacaccgatggtgtaaca
aaagaaattacacctgccgatttacctgccgaaaaggtcgagcaaattggcgaaatagta
accgaggcttatatccgtcttaattgccggggcatggcaagggttgattttattttacag
gaaagcaccaacgatttttattttatcgagattaataccactccgggtcaatcggccgcc
agtttaataccgcagcaggtacgggcggcgggtatggacgtgggcgaattttatagtgcg
cttattgagggagcggggttgtag

DBGET integrated database retrieval system