KEGG   Mucilaginibacter sp. HYN0043: HYN43_012760Help
Entry
HYN43_012760      CDS       T05668                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00620  Pyruvate metabolism
muh00680  Methane metabolism
muh01100  Metabolic pathways
muh01120  Microbial metabolism in diverse environments
muh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HYN43_012760
  09102 Energy metabolism
   00680 Methane metabolism
    HYN43_012760
Enzymes [BR:muh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HYN43_012760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Skp1_POZ bPH_1
Motif
Other DBs
NCBI-ProteinID: AYL96106
LinkDB All DBs
Position
complement(3202631..3205207)
Genome map
AA seq 858 aa AA seqDB search
MSPTLKLNQREAAFNNEVVTRFELYNSLFQTLPFYQVKDTGILLPFFSSHCEKGAITHGS
PTEIIESFFEKYVPDIDHREQINRMFRFIQYIERQVVLFDAIEDSSFNKIGKFDDSGTLQ
SLLQHAAISDEARQDISEKLKDFSLRLVLTAHPTQFYPGTVLGIMTDLIEAVKTNDITNI
DVLLQQLGKTPFFNKTSPTPVDEAISLSWFLENIFYHAISDIQAKLEDEFDIDAASRQIL
ELGFWPGGDRDGNPNVTTQTTKEVAAYLRTRLFRCYYRDFRTLKRRITFRGVEQAMAKLE
SLFYRNANEQLTPVDLQGEILELLLSIKQVILKDHDGLFVDIVEDMIQKVRLFGCYFATL
DIRQDSRILRKVFEYCTKNIDTEVPEGYGELSEVEKIKAIIFKEADFVCPEEEQDAMIHD
TLDTIRLVKEIQKGNGEKACQRFIISNCQRASDILQLIDLFLWSGWKKDNLSIDFMPLFE
TVNDLEHAAGIMEQLYTHPFYAEHLKNRGNQQTIMLGFSDSTKDGGYLMANWSIYKAKVE
LTAMARKYGIQLAFFDGRGGPPARGGGKTHRFYASMGNEIANDHIQLTIQGQTVSSQYGS
VETARFNMEQLINAGVVSALHPNRNDLLDSRHKELIQQMADISYKLFVDLRAHPLFVEYL
EKFSPLKLLSRINISSRPTKRNAGAQLKLEDLRAISFVTSWSQLKQSIPGFYGVGTALKS
VKESGGWDEIKELYQTSGFFKTMLDNCMMSMSKSDFRVTAYLEQDEKFGEFWKTLKDEFV
LTREMLLELTGSTVLMEEYPVERRSIAIREKIVLPLVIIQHYALQCLNNEKDTELNDVYN
KLVIRTVYGIVNAGRNLA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaacgttaaaactcaaccaaagagaagcagcctttaacaacgaggttgttacc
cgatttgagttatataacagtttgtttcaaacgctaccgttttaccaggtaaaagatacc
ggtatcttattgccgttcttcagttcacattgcgaaaagggtgctattacccatggctcg
ccaaccgagatcatcgaatcgtttttcgaaaagtacgtaccggatatcgatcaccgggaa
cagatcaaccgtatgttcaggtttattcagtatattgaacgtcaggtagttttgtttgat
gccattgaagattcgtcatttaataaaataggtaagtttgatgatagtggtaccctgcaa
agccttttgcaacatgctgctattagcgatgaggcccgccaggacattagcgaaaagctg
aaagatttttcattacgcctggtacttaccgcacacccaacccagttttatcctggtacg
gtattaggcatcatgaccgacctgattgaagccgtaaaaaccaacgatattaccaatatc
gatgtgttgttgcaacaattgggcaaaactcctttctttaataaaacatcgccaacgccg
gttgatgaagccatcagcctgtcgtggtttttggaaaatatattttaccatgccatatca
gacattcaggctaagcttgaagatgagtttgacatcgacgctgcgagccgccagatattg
gagcttggcttttggccgggcggcgaccgtgatggtaaccctaacgtaaccacccaaacc
actaaagaagtagctgcttacctgcgtacgcgtctgttcaggtgttactaccgcgatttc
cgtacgctgaaacgccgtataactttccgcggtgtggagcaggctatggccaaactggaa
agcctgttttaccggaatgctaatgagcaattaaccccggttgatttgcaaggcgagata
ttggaactgttgctttcaataaaacaggttatcctgaaagatcacgacggtttgtttgtt
gatattgttgaggatatgatccagaaggtgcgcctgtttggatgctattttgcaacgctg
gatatcaggcaggatagccgcattttgcgcaaagtatttgaatactgtaccaaaaatatt
gataccgaagtacctgaaggctacggcgaactaagcgaagtagagaaaataaaggccatc
atatttaaagaggctgattttgtttgccctgaagaagagcaggacgccatgatccacgat
acgctggatactataaggctggttaaggaaatacagaaaggcaatggcgaaaaagcttgc
cagcgctttattatcagcaattgccagcgtgcatctgatatccttcagcttatcgacctg
tttttatggagcggttggaaaaaagacaaccttagcattgattttatgccgctgtttgaa
actgtgaacgatttggaacatgcggccggtattatggagcagttatacacgcatccgttt
tacgccgaacacctgaaaaaccgcggcaaccagcaaaccattatgcttggtttctcggat
agtactaaagatggcggttatttaatggctaactggtctatttacaaggctaaagttgag
cttaccgctatggcccgtaaatatggtatccaactggcgttttttgatggcaggggtggt
ccgccggcacgtggtggtggtaaaactcaccgtttttatgcatcgatgggtaatgagatc
gctaacgatcatatccagttaaccatccaggggcaaactgtaagctcgcaatacgggtcg
gttgaaaccgcaaggtttaacatggagcagctgattaacgcgggcgtggtatcagccctg
catccaaaccgtaacgatttgctggatagccgccataaagaattgattcagcaaatggcc
gatatcagctacaagctgtttgttgatctgcgcgcgcatccgctgtttgtagaatatttg
gaaaaattcagtccgctgaaattattatcgagaatcaatatcagcagccgtccaactaaa
cgtaacgccggtgcgcaactgaaactggaagatttaagggctatcagctttgtaacttca
tggagccagttgaaacaaagcatccccggtttttacggtgtaggtaccgcgctgaaaagt
gtaaaagaaagcggcggttgggacgagatcaaagaactttatcaaacatcaggtttcttt
aaaaccatgctggataactgtatgatgtcgatgtcaaaatctgatttccgcgtaacagca
tacttagagcaggacgagaaattcggtgagttctggaaaacgctgaaagacgagtttgta
cttacccgcgaaatgttgctcgaactaaccggcagcaccgtactgatggaagaatacccg
gttgagcgccgttctatcgccatccgcgagaagattgtgttgccgctggtaattatccag
cactatgccctgcaatgtttaaataacgaaaaagacaccgagcttaatgatgtttacaac
aagcttgtgatccgtacggtttacggtatagtaaatgccggccgtaacctggcttag

DBGET integrated database retrieval system