KEGG   Mucilaginibacter sp. HYN0043: HYN43_015830Help
Entry
HYN43_015830      CDS       T05668                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00473  D-Alanine metabolism
muh01100  Metabolic pathways
muh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HYN43_015830
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HYN43_015830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:muh01011]
    HYN43_015830
Enzymes [BR:muh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HYN43_015830
Peptidoglycan biosynthesis and degradation proteins [BR:muh01011]
 Precursor biosynthesis
  Racemase
   HYN43_015830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C RWP-RK PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: AYL96680
LinkDB All DBs
Position
complement(3946115..3948577)
Genome map
AA seq 820 aa AA seqDB search
MPNTTYTITAIKEIIKADGNIVHDYNISALFTDSRRISNPAEGLFFALSGRRNGHEFVAE
AYAAGIRNFVVEHGPEFNLPEANFLLVPDPLAALQALAAYHRSRFNLQVIGITGSNGKTI
VKEWLYQLLSADKNIVRNPKSYNSQIGVPLSVWQINERNDLGIFEAGISTTNEMERLEAI
IKPEIGVLTHIGPAHDEGFESRSQKIAEKLRLFKNSKLLIHNYDQLLDFKKELGAKETFT
WSRKFREADLYVFSETVISKNYYLRARYHGKEIECLIPFTDQASVENAITCWATMLALGY
SAVETDKRIERLSPVSMRLELKNGVNNCSVIDDSYNSDLQSLEIALNFLSQQNQHQKKTL
ILSDIYQSGLHQDVLYKQVAELIRTKKVDKFIAVGEALQAHQQYFDAAEQHFYSDTNTLL
QHLKLLAFKDETILIKGSRSFEFEQVSRALAQKAHETVMEINLNSLLNNLNFYKSKLKPG
VKVMAMVKAFSYGSGTFEVANMLQYNKVDYLAVAYIDEGVALRQAGINLPIKVLNPEASA
FDKLIEYKLEPVIYSFGLLDDFVTYAIGRSMVNYPVHLKIDTGMHRLGFENHEIEILCDM
LETNRYVRVQSVFSHLAASEAPEHDEFTKKQIKRFEKAFKEIERTLGYKVIKHICNTSGI
TRWPSAHYDMVRLGIGLYGIDSAVPASDAGLQPIASLKTSVAQVKKIGAGDTISYSRSGS
LAKDGKIATVRIGYADGYLRAFGKGLGKMLVKGTLVPTVGNITMDMCMLDVSGLDVREGD
EVIIFDEHQRIEELAKQIGTIPYEILTNISQRVKRVYFYE
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacactacatataccataactgccattaaagaaattattaaggccgacggtaat
attgtgcacgattacaatatcagcgcgctttttaccgatagccgccgcatcagcaatccg
gccgaagggctgttttttgcactgagcggcaggcgtaacggtcatgagtttgttgccgaa
gcctatgctgcggggatacgtaattttgtagtggagcacggcccggagtttaatttgccc
gaagctaattttttactggttcctgatccgttggctgccttgcaggccctggctgcctac
caccgcagccgttttaatttacaggtgataggtattacgggcagcaatggcaaaactatt
gttaaagagtggttgtaccagttactctcggccgataaaaatattgtacgtaaccctaaa
agctataactcgcagataggtgtaccgctttcggtttggcagattaacgagcgtaatgat
ctgggtatttttgaagccggcatctctaccacaaacgaaatggagcgccttgaagctatt
attaagccagagataggcgtgctaacccatatcggcccggcgcacgacgagggctttgaa
tcgcgcagtcaaaagattgcagaaaagctccggttgtttaaaaacagtaagctgcttatc
cataattatgatcagctgcttgattttaagaaggagcttggtgcaaaggaaacttttacc
tggagccgtaagtttcgcgaagcagatctgtatgttttcagcgaaacagtgatcagcaaa
aattattacctgcgggcacgataccatggcaaggaaattgagtgcctgatcccttttacc
gatcaggcctcggttgagaatgccattacctgctgggctaccatgctggcattgggctat
agtgccgtggagacagataaacgcatcgaacgactgagcccggtaagcatgcgcctcgaa
ctaaaaaatggtgtaaacaactgctcggttatcgacgattcgtataattccgatctgcaa
tcgttagagatagcgcttaattttttatcgcagcaaaatcagcatcaaaaaaagacactc
atcctgtcggatatttatcaatcgggcctgcatcaggatgtattgtataagcaggttgcc
gaattgatccgcactaaaaaagttgacaaatttattgctgtgggagaggctttgcaggca
catcaacaatattttgatgcagcagaacaacatttttattcagataccaacacattgctg
cagcatttaaaattgcttgcctttaaggatgaaaccatcctgataaaaggttcgcgcagt
tttgaatttgagcaggtgagccgtgcgctggcccaaaaagcgcacgaaactgtaatggag
attaaccttaactcgctgcttaacaaccttaacttttataaatcgaagcttaagcccggt
gtaaaggtaatggccatggttaaggctttcagctatggcagcggcacgtttgaggtggcc
aatatgctgcaatacaataaggttgattacctggcagttgcttatattgacgagggcgtg
gcgttgagacaggccggtattaacctgcccatcaaggtgcttaatcccgaggcctcggca
tttgataaattgattgagtataaacttgaaccggttatttacagctttggtttgcttgat
gattttgtaacctacgctattggccgcagcatggtaaattaccctgttcaccttaaaatt
gataccggcatgcaccgcctcgggtttgaaaaccacgagatagaaatcctttgcgatatg
ctggaaaccaaccggtatgtacgggtgcaatcggtattttcgcacctggcggcaagcgaa
gctccggagcatgatgagtttaccaaaaagcagatcaaacgttttgaaaaggcctttaaa
gagatagagcgaacgctgggttataaggtgattaaacatatttgcaatacatcgggcatc
acccgctggccatcggcacattatgatatggtgcggttggggataggtttgtatgggata
gattcggctgtaccggcatcagatgccggattgcagcccatagccagtttaaaaaccagt
gtggcacaggtaaaaaagataggcgcgggcgataccatcagctacagccgcagcggcagc
ctggctaaggatggcaaaattgctaccgtacgcattggttatgccgatggctatttgcgc
gcatttggcaaaggcctgggcaaaatgttggtgaaaggcacgctggtaccaaccgtgggc
aatattaccatggatatgtgtatgcttgatgtaagcggcctcgacgtgcgcgaaggcgac
gaggtgattatatttgatgaacaccagcgtattgaagaactggccaaacagataggcacc
attccttatgaaatattaactaatatttcgcaacgggttaaaagggtgtacttttacgaa
taa

DBGET integrated database retrieval system