KEGG   Mucilaginibacter sp. HYN0043: HYN43_021185Help
Entry
HYN43_021185      CDS       T05668                                 

Definition
(GenBank) TIR domain-containing protein
  KO
K13730  internalin A
Organism
muh  Mucilaginibacter sp. HYN0043
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIR_2 LRR_4 Roc LRR_8 TIR LRR_9 Ras
Motif
Other DBs
NCBI-ProteinID: AYL97650
UniProt: A0A494VVZ1
LinkDB All DBs
Position
5156759..5159899
Genome map
AA seq 1046 aa AA seqDB search
MSNSDIPNIFISYSHYDKSYKTTLEHYLKILPLNFNLLSDDLLTGADEWKGKLDTMRESA
DIFLLLVSPDYLSSETVRNELAHIYSIKTENRKILPVILKPCNWKGYEFSSYQVVPKFGE
PVSTFMDFEAAYKEIVTTVSSFLSPLNPRALWNIGVEIHDRTGTLDLSSCNLEYIPELLW
GMDWISKLILKQNLIQEIYHLDNMVNLEVLDLSKNQIKKIENLNANKRLSTLYLSDNSIV
KIESLSSLISLVILDLGSNNIEEINGLSVCVNLKALRLSYNQIKVIANISQLKNLKSFYI
SHNLVEEIEDLESLHSLNLIHLTDNKLVTLRPLLWHIQNGLPVYYDKAENLPDVGITIAN
NNLLAEPPPELVIKGNEEIIRYFEEADRFGLNNVNILKLVLVGNSRAGKTNFSEFIRTNK
ITLNSTSTDLLDIQFWRSPFNDEKGGQAIQINIFDFGGQDYYHDAHKMFYSSDTAYILLW
DQESNHYEEREDADNITYENYPLEYWLESIKYNLSEKSKEVLSTVNTSLPPVLIIQNKID
LAPQQPTYKRQYVDQQRLAKENDNIWGFFDISLLTGKRTSILLEVLGEFIKSVPLAGRNL
LSYEHEIVLHYLKKNKELKVMSIDEFWRDCKSRIKGPTVSFKEVNARVLAHIMNNMGIVY
FDQKDKIYTDVARLNVQIKKIMELAKKGQDKGIFYDHQLVNIPFNKEILELLAQNSSIIK
IGPSAYLAPQFLPVKPEARIEFFLPAFRHNQVRFMYDAYFHKNILLRLFSKYLEGANMEE
AEGIKNLPFWRNGIMIANTEGDEKKIILIEFEKNTNCGIINMRTLTQFSKHKFEGDVMRT
LEQLNAGCSVKKMISVNSRQFFEVNWLKEQVNAGQYVFYKDNNTFSINGLKHMEHFERVP
KKLFISYSSANAAFVKRFITHLQVLKNEKLIEPWYDRMIEPGTKWDDTIRQEMKNSDLIV
FLLSPDFLATQYIMETEIPLAIDQFSDDYSKFFFIELHPSSWRRTKLSQFQQTSNNQATE
KNVTQIKDVNADDKWLEAIEALRTLL
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactctgatatacctaacattttcatatcatattctcactatgacaaaagctac
aaaacaacattagagcattatctaaaaattctgccgctgaacttcaacctgctttccgac
gatctgctaacaggtgcagatgagtggaagggaaaattagataccatgcgcgaaagtgca
gatatcttcctcttgttggtctctccggattatctttcttccgaaactgttagaaatgaa
cttgcccatatatatagtatcaagacggaaaacagaaagatattacctgtcatattaaag
ccctgtaactggaaaggttatgagtttagcagttaccaggtcgtccctaaattcggcgaa
cctgtttcaacttttatggacttcgaggcggcctataaagagattgtgacgacagtaagt
tcattcctgtctccgctcaacccaagggcattatggaatattggtgtggaaatccatgat
cgtaccgggacactcgatcttagtagctgtaatctcgagtatattcctgaattattgtgg
ggaatggattggatatcgaaactgattttaaaacaaaatcttatacaagaaatctatcac
cttgacaatatggtgaatttagaagtcttggatttaagtaaaaatcaaattaaaaaaatc
gagaaccttaatgctaataaacgcttatccacactttacctatcagataattcaatagta
aaaattgaatcgctcagttcccttatatcactggtcatacttgatcttggcagcaataat
atcgaagaaattaacggattatctgtttgtgttaatttaaaggcattacgcttgtcgtat
aatcaaataaaggttattgcaaatattagtcaactaaaaaatctcaaaagcttttatata
tctcacaatttagttgaagaaattgaagatctcgaaagcttacactcactaaaccttatt
catctaacagacaataaattagtaacattaagaccccttttatggcatatccaaaatgga
ttacccgtatattatgataaagccgaaaacctacctgatgttggaattacgatagcaaac
aacaatctattggcagaaccccctccggaattagtaataaaaggcaatgaggaaataata
agatattttgaagaagcagacaggtttggtcttaataatgttaacattcttaaattagtg
cttgttggcaatagcagggcaggtaaaacaaatttcagcgaatttatacgcacaaataaa
atcaccctaaacagcacctcgacagatttacttgacattcaattctggcgatctcctttt
aacgatgaaaaaggcggacaagccattcaaattaatatttttgatttcggtggccaggat
tactatcacgatgcccacaaaatgttttactcaagcgataccgcatatattttgctgtgg
gaccaggaaagtaatcattatgaagagagggaagatgccgataatataacctatgaaaat
tatcccctggagtattggctcgaatctattaaatacaatttgtcagaaaaatccaaagag
gtattatcaactgtaaacacctccctgcctccggttttgattatccaaaacaaaatagat
ctcgccccgcaacagccgacatataagcgacagtatgttgatcagcaaagattagctaaa
gagaacgataatatctggggtttttttgatatttctttactaacaggtaaaagaacgtca
atcttattagaggtattaggcgaatttattaaatctgtacccttagccgggcgcaactta
ttaagctacgagcacgaaattgttctgcattacctgaagaaaaataaagagttgaaggta
atgtctatagatgagttctggcgtgattgcaaatcaagaattaaaggcccaactgtttct
tttaaagaagtgaacgcccgggtactggctcatattatgaataacatgggcattgtttat
tttgaccaaaaggacaaaatctataccgatgttgcccggctaaatgttcaaattaaaaag
ataatggagcttgcaaaaaaagggcaggacaaaggtatcttttacgatcaccagcttgta
aatatccctttcaataaagaaattcttgaacttttagcgcaaaacagttctattatcaaa
attgggccttcggcttatttggctcctcaatttctaccagtaaaaccagaggcaagaatt
gaattctttttacccgctttcaggcataaccaggtgcgctttatgtacgatgcctatttt
cataaaaacatcctgttgaggttattttcaaaataccttgagggtgccaatatggaagag
gctgaaggcataaagaaccttcccttttggcgcaatggtattatgattgccaacactgag
ggcgacgaaaagaaaataatattaattgaatttgaaaagaataccaattgcggtataatc
aatatgcgcacccttacgcagttttcaaaacataaatttgaaggcgatgtaatgcgtaca
cttgaacaattaaacgccggatgctctgttaaaaaaatgatttctgtaaacagccgtcaa
ttctttgaggttaactggttaaaagaacaggtaaatgccggccagtacgtattttataaa
gataataatacttttagtattaatggccttaagcacatggagcattttgaacgtgttcca
aaaaaacttttcatttcatactcgtctgcaaatgccgcctttgtaaagcgcttcattaca
catttacaggtattaaaaaatgaaaaattgattgagccgtggtatgacaggatgattgaa
cctggcacaaaatgggatgatacaatcagacaagaaatgaaaaactctgatctgatcgta
tttctattaagtcccgattttttagcaacccaatatataatggaaaccgagattccgttg
gcaatagatcaattttcggatgattattcaaagtttttctttattgaacttcaccccagt
agctggcgccgaaccaagctttcacaatttcaacaaacatcaaataatcaggcaaccgaa
aaaaatgtcacccagattaaagatgtcaacgctgatgataagtggctcgaagctatcgaa
gcactccgaacgctattgtag

DBGET integrated database retrieval system