KEGG   Mucilaginibacter sp. HYN0043: HYN43_026050Help
Entry
HYN43_026050      CDS       T05668                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00010  Glycolysis / Gluconeogenesis
muh00020  Citrate cycle (TCA cycle)
muh00620  Pyruvate metabolism
muh01100  Metabolic pathways
muh01110  Biosynthesis of secondary metabolites
muh01120  Microbial metabolism in diverse environments
muh01130  Biosynthesis of antibiotics
muh01200  Carbon metabolism
Module
muh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYN43_026050
   00020 Citrate cycle (TCA cycle)
    HYN43_026050
   00620 Pyruvate metabolism
    HYN43_026050
Enzymes [BR:muh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HYN43_026050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C DUF2118 GCV_H QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AYL98530
UniProt: A0A494VYI0
LinkDB All DBs
Position
6256948..6258603
Genome map
AA seq 551 aa AA seqDB search
MAEVVKMPKMSDTMTEGVLAKWHKKVGDKVKSGDVLAEIETDKATMDFESYQDGTLLYIG
IQEGAAAPVDAVIAILGKEGEDYKSLLDQAGSAPAAEPAKEAAPVADKAPAATPAPAAPK
VDLSSIPATVIRMPLLSDTMTEGTIEKWNFKVGDKVKADDSLADVATDKATMEVVGYEAG
TLLYIGLKEGEAAKVNDIIAIVGKEGTDITPLLQDGGSAPAAEAAPAAETKSETAAATAT
ATEASSEDDSRVKASPLARKIAKDKGINLNDIKGSAEGGRIIKKDVEEYTPSAKAAAPAA
EAAPAAAPSAAPAKAPIVLPTFTGEEKFSERPVTQMRKAISRRLSESLFTAPHFYVTMSI
DMDQAITARNRMNEVAPVKISFNDFVVKACAVALRQHPAINSSFLGDKIRTNEHVHVGVA
VAVDEGLLVPVIKFADGKSLSHISVEVKEFAGKAKSKKLQPAEMEGSTFTISNLGMFGVD
EFTAIINTPNACILAVSGIQAVPVVKNGAVVPGNIMKVTLSADHRVVDGATAAAFLQTLK
QLLEEPVRLLI
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtagtaaaaatgcctaagatgagcgataccatgaccgaaggggtattggct
aaatggcataaaaaagttggcgataaggtaaaatcgggcgatgtattggccgagattgaa
accgataaagctaccatggattttgaatcgtaccaggatgggaccctgctgtatatcggt
atacaggaaggtgctgctgctccggttgatgccgttattgccattttaggtaaagagggc
gaagattacaaatcattgcttgaccaggctggaagcgcccctgctgcagaacctgctaaa
gaagctgctccggtagctgataaagcacctgccgctactccggcaccggctgctcctaag
gttgacctttcaagcatcccggctacggttatccgcatgccgttgcttagcgataccatg
accgaaggcaccattgaaaaatggaactttaaagttggcgataaagtaaaagctgatgat
tcactggctgatgtggctaccgataaagctaccatggaagttgtgggttacgaagcaggt
actttattatatatcggccttaaagaaggcgaagccgctaaagtaaatgacattattgct
atagtaggtaaagaaggtaccgatatcacgcctttattacaggatggtggttcggcccct
gctgctgaagctgcaccagctgctgaaaccaaatcagaaactgccgctgcaactgctact
gccaccgaagcttcatctgaagatgacagccgcgtaaaagcatctccgttagcacgtaaa
atagctaaagataaaggcatcaaccttaatgatataaaaggcagcgccgagggcggccgt
atcattaaaaaagatgttgaagaatatacaccatctgctaaagctgctgctccagctgcc
gaagccgcgcctgccgctgctccgtcggccgcacctgcaaaagcacctatcgtactgcca
acctttacaggcgaagagaaatttagcgaaaggccggttactcaaatgcgtaaagctatc
agccgccgcttaagcgaaagcttgttcactgctccgcatttctacgtaaccatgagcatt
gatatggatcaggcaatcactgcccgtaaccgtatgaatgaggttgccccggttaaaatt
tcatttaacgattttgttgttaaagcttgtgctgttgcattacgccagcacccggctatc
aactcttcgttcctgggcgataagatccgcactaacgagcatgttcacgttggtgtagct
gttgccgttgatgaaggtttgttagtaccggttattaaatttgccgatggtaaatcatta
agccacatctcggttgaagtgaaagagtttgccggtaaagcaaaatctaaaaaattgcaa
ccagccgaaatggaaggttcaaccttcaccatttcaaacttaggtatgtttggtgttgac
gagtttacggccatcattaacacaccaaacgcttgtatccttgctgttagcggcatccag
gctgttccggttgttaaaaatggtgccgtagtacctggcaacatcatgaaggtaacccta
agcgccgaccaccgcgtggttgacggtgctacagccgctgccttcctgcaaaccttaaaa
caattattagaagagccggtaaggcttcttatataa

DBGET integrated database retrieval system