KEGG   Mucilaginibacter sp. HYN0043: HYN43_026700Help
Entry
HYN43_026700      CDS       T05668                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00220  Arginine biosynthesis
muh00250  Alanine, aspartate and glutamate metabolism
muh00270  Cysteine and methionine metabolism
muh00330  Arginine and proline metabolism
muh00350  Tyrosine metabolism
muh00360  Phenylalanine metabolism
muh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
muh00401  Novobiocin biosynthesis
muh01100  Metabolic pathways
muh01110  Biosynthesis of secondary metabolites
muh01130  Biosynthesis of antibiotics
muh01210  2-Oxocarboxylic acid metabolism
muh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HYN43_026700
   00270 Cysteine and methionine metabolism
    HYN43_026700
   00220 Arginine biosynthesis
    HYN43_026700
   00330 Arginine and proline metabolism
    HYN43_026700
   00350 Tyrosine metabolism
    HYN43_026700
   00360 Phenylalanine metabolism
    HYN43_026700
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HYN43_026700
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    HYN43_026700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:muh01007]
    HYN43_026700
Enzymes [BR:muh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     HYN43_026700
Amino acid related enzymes [BR:muh01007]
 Aminotransferase (transaminase)
  Class I
   HYN43_026700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AYL98642
UniProt: A0A494W5S7
LinkDB All DBs
Position
complement(6407134..6408390)
Genome map
AA seq 418 aa AA seqDB search
MSVSLLAQNLHGSEIIKIAGEINELKRQGQNIANLTIGDFDSNIYPIPTPLKDKIIDAYN
HNQTNYPAADGMLDLRQSVSGFLKKSFDLDYAPNQILISGGSRPLIYSIFLAVVNPGEKV
VFPAPSWNNNHYSDLLNAEPVIIPTTPENNFMPTADDIRPHLKGAALLALCSPLNPTGTM
FSKKDLEEICDLVIAENKTRTAGEKPLYLLYDQIYSQLTFGDHKHYNPVTLRPELKDYTI
FVDGGSKCFAATGVRVGWGFGPELVIENMKAIVGHMGAWSPKPEQMAMAKFLTDESDVNS
YLADLKEKIQASLTALHEGFQEMKTSGLNVDSIEPMGAIYLTLKIDYAGKTTPDGKALKD
SADINFYLIKEAGAAFVPFSAFGTGDDVNWFRASVGATPLNEIEALIPRVKAALSKLK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtttctttattagctcaaaatttgcacggctccgagattatcaaaatcgcgggc
gagatcaacgaattaaaacgccagggccagaatatcgctaacttaaccatcggcgatttc
gactcaaacatttatcctatccctacccccttaaaggataagatcattgatgcctataat
cataaccaaaccaactatccggctgccgatggtatgctggatttgcgccagagtgtaagc
ggctttttaaaaaagagcttcgatcttgactatgctcccaaccagatcctgatttcgggc
ggttcacgtccgttaatctattctatatttttggcagtagttaatcccggcgaaaaagtg
gttttccctgccccatcatggaacaataaccactacagcgatttgctgaacgccgaaccg
gttattatcccaaccactcccgaaaataactttatgcctacggccgatgatatccgtccg
catttaaagggagctgctttgttggctttatgttcgccattaaacccaaccggcaccatg
ttcagcaaaaaggacctggaagagatttgcgatttggttatagccgaaaacaaaacccgt
acggccggcgaaaaaccattgtacttattgtacgatcagatctattcgcaattaactttt
ggcgatcataaacattataacccggtaacacttcgcccggaattaaaagattacaccatt
tttgttgatggcggttcgaaatgttttgcagctaccggtgtacgtgtgggctggggtttt
ggtccggaattggtaatagaaaatatgaaagccattgttgggcacatgggcgcctggtcg
ccaaagcctgagcagatggctatggctaaatttttaaccgacgagagtgatgtaaattca
taccttgctgatttaaaagaaaagatccaggccagccttacggcactgcacgaaggtttc
caggaaatgaaaaccagtggtttgaacgtggattcgatagaaccaatgggtgccatctac
ctaaccctgaaaatagattacgccggcaaaactacgcccgatggcaaggcgcttaaagat
tcggcagacattaatttttatttaattaaagaagccggagccgcatttgtaccattttca
gcattcggtaccggcgatgatgtaaactggttccgcgcatcggttggcgctacgccgctg
aatgagattgaggctttgataccgagggtaaaagcagcgttaagtaagttgaaataa

DBGET integrated database retrieval system