KEGG   Mycobacterium ulcerans: MUL_0879Help
Entry
MUL_0879          CDS       T00435                                 

Gene name
alr
Definition
(GenBank) alanine racemase, Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00473  D-Alanine metabolism
mul01100  Metabolic pathways
mul01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MUL_0879 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MUL_0879 (alr)
Enzymes [BR:mul01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MUL_0879 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mul01011]
 Precursor biosynthesis
  Racemase
   MUL_0879 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABL03511
Pasteur: MUL_0879
UniProt: A0PME2
LinkDB All DBs
Position
918908..920074
Genome map
AA seq 388 aa AA seqDB search
MTTTPISLTPGVLAEAVVDLGAIAHNVRLLRERAGSAQVMAVVKADGYGHGATAVARTAL
AAGAVELGVASVDEALTLRADGITAPVLAWLHAPGMDFGPALAADVQIAISSIRQLDEAL
DAARRTGTTATVTVKIDTGLNRNGVAPALYPEMVTRLRQAVAEDAIRLRGLMTHMVHADA
PEKPINDIQSQRFKQMLDHARDQGVRFEVAHLSNSSATMARPDLTLDLVRPGIAVYGLSP
VPRLGDMGLVPAMTVKCAVALVKSVSAGEGVSYGHTWIAPHDTNVALLPIGYADGVFRSL
GGRLEVLINGKRRPGVGRVCMDQFLVDLGPGPLDVAEGDEAILFGPGTRGEPTAQDWADL
VGTIHYEVVTSPRGRITRVYREAETVER
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaccccgatatctctgacgcccggggtcctcgccgaggcggtggtggacctg
ggcgctatcgcccacaacgtgcggctgctgcgcgaacgtgccggcagcgcacaagtcatg
gcggtcgtcaaggccgacggctatggtcacggcgccaccgcggtcgcccgcaccgcgctg
gcagccggtgcggtggaactcggagtggcgtcggtggacgaggcgctgacgttgcgcgcg
gacggcatcaccgccccggtgctggcctggttgcacgcacccggcatggatttcgggccc
gcgctggccgccgacgtccagatcgccatttcttcgatccgccaactcgacgaagcgctc
gatgccgcgcgccggaccggaacgacggcgaccgtcacggtcaagatcgacaccggcctc
aaccgcaacggcgtggcgccggcgctctacccggagatggtgaccaggctgcgccaggcc
gtcgccgaagacgcgattcggctacgcgggctgatgacgcacatggtgcacgccgacgca
ccggaaaagccgatcaacgacatccagtcccagcggttcaagcagatgctcgaccacgcc
cgcgaccagggagtgcgattcgaggtggcacacctgtcgaactcctcggcaaccatggct
cgtcccgatctgacgctggatctggtgcggcccggcatcgcggtgtacgggctgagcccg
gtgcccaggttgggcgacatgggactggttccggcgatgaccgtgaaatgcgcagtcgcg
ctggtgaaatcggtgagcgcgggcgaaggcgtgtcgtacgggcacacctggattgcgccc
cacgacacgaatgtggcgctgttgccgatcggctacgccgacggggttttccggtcgctg
ggcgggcgcctggaggtcttgatcaacggcaaacgccggccgggcgtcggccgggtctgc
atggaccagttcctcgtcgatctgggccccggaccgctcgatgtggccgaaggcgacgag
gcgattctgttcgggccgggtacccgcggtgaacccaccgcgcaggactgggccgatctg
gtcggcaccatccactacgaggtggtgaccagcccgcgcgggcgcatcaccagggtttac
cgcgaggccgaaaccgttgagcgctga

DBGET integrated database retrieval system