KEGG   Mycobacterium ulcerans: MUL_1723Help
Entry
MUL_1723          CDS       T00435                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00250  Alanine, aspartate and glutamate metabolism
mul00280  Valine, leucine and isoleucine degradation
mul00310  Lysine degradation
mul00410  beta-Alanine metabolism
mul00640  Propanoate metabolism
mul00650  Butanoate metabolism
mul01100  Metabolic pathways
mul01120  Microbial metabolism in diverse environments
Module
mul_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MUL_1723 (gabT)
   00650 Butanoate metabolism
    MUL_1723 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MUL_1723 (gabT)
   00280 Valine, leucine and isoleucine degradation
    MUL_1723 (gabT)
   00310 Lysine degradation
    MUL_1723 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MUL_1723 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mul01007]
    MUL_1723 (gabT)
Enzymes [BR:mul01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MUL_1723 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MUL_1723 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     MUL_1723 (gabT)
Amino acid related enzymes [BR:mul01007]
 Aminotransferase (transaminase)
  Class III
   MUL_1723 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABL04208
Pasteur: MUL_1723
UniProt: A0PPD9
LinkDB All DBs
Position
complement(1902469..1903809)
Genome map
AA seq 446 aa AA seqDB search
MASLDQSRLLVTEIPGPASLELNKRRAAAVSGGVGVTLPVFVVRAGGGIVEDADGNRLID
LGSGIAVTTIGNSAPRVVDAVRDQVEQFTHTCFMVIPYEHYVAVAEQLNRITPGSGEKRT
VLFNSGAEAVENSIKVARAHTRKQAVVAFDYAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPVSYPYRDNLLDKDIATDGELAAERAINLIDKQIGAANLAAVIIEPIAGEGGFIVP
ADGFLPALQRWSRDNDVVFIADEVQTGFARTGAMFACDHENVEPDLIVTAKGIADGFPLS
AVTGRAEIMDAPHTSGLGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLR
LQAADDRLGDVRGRGAMIAMELVKSGTAEPDAALTQKLAAAAHAAGVIVLTCGMFGNVIR
LLPPLTISDELLSEGLDILCQILADL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctcgatcaaagtcgtctcttggtcaccgaaatccccggccccgcgtcgttg
gagctcaacaagcgccgggccgcggcggtgtcgggtggcgtcggggtcaccctgccggtg
ttcgtggttcgcgcgggtggcggaatcgtggaggacgccgacggcaaccggctgatcgac
ctcggctccggcatcgccgtcacgactatcggcaattcggcgccccgcgtggtggacgcg
gtacgggaccaggtggagcagttcacccacacctgcttcatggtgatcccctacgagcat
tacgtggccgtcgccgaacagctcaatcggatcaccccgggctccggcgagaagcggacg
gtgctgttcaactccggcgccgaggcggtggagaactccatcaaggtcgcccgcgcgcac
acccgtaagcaggccgtggtcgcgttcgactacgcctaccacggccgcaccaacctgacg
atggcgctgaccgccaagtccatgccgtacaagagcggcttcggcccctttgcgccggag
atctaccgcgcaccggtgtcctacccctaccgggacaacctgctcgacaaagacatcgcc
accgacggtgagcttgccgccgaacgcgccatcaacctcatcgacaagcagatcggcgcc
gccaacctggccgcggtcatcatcgaaccgatcgcgggcgagggcggcttcatcgttccg
gccgacggtttcctgcccgcgctgcagcggtggtcccgcgacaacgacgtggtgttcatc
gccgacgaggtgcagaccggatttgcccgcaccggcgccatgttcgcgtgcgaccacgag
aacgtcgagcccgacctgatcgtcaccgccaaaggcatcgccgacggattccccttgtcg
gcggtcaccggccgggccgagatcatggacgccccgcacaccagcggcttgggcggcacc
ttcggcggcaacccggtcgcgtgtgcggcggccctggccaccatcgaaacgatcgaacgc
gacggcatggtcgaacgggcccgccagatcgaacgactggtgatggaccgattgctgcgc
ctgcaagccgccgatgaccgtctcggcgatgtgcgcggccgcggcgccatgatcgccatg
gagctggtgaaatcgggcactgccgaacccgacgctgcgctcacccaaaagctggccgcc
gccgcccatgctgccggcgtaattgtcttgacgtgcggaatgttcggcaacgtgatccgg
ctgctgccaccactgacgatcagcgacgagctgctgtccgaaggcctcgacatcctgtgc
cagatcctggccgacctctag

DBGET integrated database retrieval system