KEGG   Mycobacterium ulcerans: MUL_1940Help
Entry
MUL_1940          CDS       T00435                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00010  Glycolysis / Gluconeogenesis
mul00030  Pentose phosphate pathway
mul00051  Fructose and mannose metabolism
mul00052  Galactose metabolism
mul00680  Methane metabolism
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
mul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_1940 (pfkA)
   00030 Pentose phosphate pathway
    MUL_1940 (pfkA)
   00051 Fructose and mannose metabolism
    MUL_1940 (pfkA)
   00052 Galactose metabolism
    MUL_1940 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MUL_1940 (pfkA)
Enzymes [BR:mul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MUL_1940 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MUL_1940 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: ABL04394
Pasteur: MUL_1940
UniProt: A0PPX5
LinkDB All DBs
Position
2146039..2147070
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDARYGSSVVGFQDGWRGLLENRRLQLRNDDRNDR
LLAKGGTMLGTARVHPDKLRAGLPQIKQTLDDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALMVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
SGLASGAHMTLIPEQPFDIEEVCRLVKQRFQRGDSHFICVVAEGAKPVSGSMQLREGGLD
EFGHERFTGVAAQLGWEVEKRINKDVRVTVLGHVQRGGQPTAYDRVLATRFGVNAADAAH
AGEYGQMVSLRGQDIGRVPLADAVRQLKLVPQSRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggattggagtactcacgggaggcggcgactgtccagggctgaatgcggtgatccgg
gcggtggtgcgcacttgcgacgcccggtacggctcatcggtggtcggatttcaggacggc
tggcgcgggttgctggagaaccggcggctgcagttgcgcaacgacgaccgcaacgaccgg
ctgctggccaagggcggaacgatgctcggcaccgcccgcgtacaccccgacaaactgcgg
gccgggttgccccagatcaaacagacgttagacgacaacggcattgacgtgctcatcccg
atcggcggcgaaggcacgctgaccgccgcacactggctgtccgaagagaacgttccggtg
gtcggcgtgcccaagacgatcgacaacgacatcgactgcaccgatgtgactttcggccac
gacacggccttgatggtggcaaccgaggccatcgacaggctgcacagcaccgcggaatcc
caccagcgggtgatgctggtcgaggtgatgggtaggcatgcgggctggatcgcgctgaac
tccgggctggcatctggcgcacacatgacgctcatccctgagcagcccttcgacatcgaa
gaggtgtgccgtctggtcaaacagcgcttccagcgaggcgattcgcacttcatctgtgtg
gtcgccgagggcgccaagcccgtttcgggctcgatgcagttgcgcgagggcggactcgac
gaattcggtcacgaacgattcaccggcgtcgccgctcagctcggctgggaagtggaaaag
cgcatcaacaaggatgtccgggtgaccgtgctgggccacgtgcaacggggcggacagccg
acggcctacgaccgggtgctggccacccggttcggcgtcaatgccgctgacgccgcacat
gcgggcgaatacggccagatggtgtcgctgcgcggtcaggatatcggccgtgtacccctg
gccgacgccgttcgacagctcaagctggtaccgcaaagccgctacgacgacgccgctgag
ttcttcggctga

DBGET integrated database retrieval system