KEGG   Mycobacterium ulcerans: MUL_2142Help
Entry
MUL_2142          CDS       T00435                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine synthase B TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
mul  Mycobacterium ulcerans
Brite
KEGG Orthology (KO) [BR:mul00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mul03016]
    MUL_2142 (truB)
Enzymes [BR:mul01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     MUL_2142 (truB)
Transfer RNA biogenesis [BR:mul03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    MUL_2142 (truB)
 Prokaryotic type
    MUL_2142 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C TruB_C_2 PSD1
Motif
Other DBs
NCBI-ProteinID: ABL04558
Pasteur: MUL_2142
UniProt: A0PQD9
LinkDB All DBs
Position
2390698..2391603
Genome map
AA seq 301 aa AA seqDB search
MSRQNAGPGFGPGIVVVDKPGAMTSHDVVGRCRRIFGTRRLGHAGTLDPMATGVLVIGIE
RATKILGLLIATSKSYAATIRLGQTTSTEDAEGEPLASVSAEHVAPEAIAAAILDLTGDI
RQVPSAVSAIKVDGRRAYQLAREGQTVELAARPVRIDRFELMDLRRGADVIDIDVEVDCS
SGTYIRALARDLGAALDVGGHLTSLRRTRVSHFDLSQAASLDELAERPALSLTLDQACLL
MFPRRDLTVDESQSVGNGRPLEPAGIDGIYAASDADGRVIALLRDEGRRTKSVVVIRPAT
M
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagaacgccggtcccggctttggcccgggcatcgttgtggtcgacaagccg
ggcgcaatgaccagccacgacgtggttgggcgctgccgcaggatctttggcacccgccgg
ctcggccacgcgggaaccctggacccgatggccaccggtgtgctggtgatcggcatcgag
cgtgccaccaagatccttggcctactgatcgccacgtcgaagtcgtacgccgccaccatc
cggttgggccagacgacctccaccgaggacgccgaaggcgagccgctggcctcggtgtcc
gccgaacatgtcgcacccgaggcaatcgcggcggcgatcttggatttgactggcgacatc
agacaagttccgtcggcggtcagcgcgatcaaggtggacggccggcgcgcgtatcaactg
gcccgggaaggccagacggtcgagcttgcggcgcgcccggtgcgcatcgaccgattcgag
ctgatggatcttcggcgcggcgccgatgtgatcgatatcgacgtcgaagtcgactgctcg
tcagggacctacatccgcgccctggcgcgcgatcttggtgcggcgctcgatgtgggcggc
catttgacgtcgctgcggcgcactcgcgttagtcacttcgacctgtcccaggccgcgtca
ctcgacgagctggccgagcggccggcgctgagcctgaccctcgatcaggcctgcctgctg
atgtttccgcgccgcgacctcaccgtcgacgaatctcagtccgtgggcaacggtcgtccc
cttgaaccggccggaatcgacggcatctacgccgccagcgatgccgatggccgggtgatt
gcgctgttgcgcgacgaggggcgccgcaccaagtcggtggtggtgatccgcccggcgacg
atgtag

DBGET integrated database retrieval system