KEGG   Mycobacterium ulcerans: MUL_3141Help
Entry
MUL_3141          CDS       T00435                                 

Definition
(GenBank) esterase/lipase
Organism
mul  Mycobacterium ulcerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: ABL05367
Pasteur: MUL_3141
UniProt: A0PSP8
LinkDB All DBs
Position
complement(3490098..3490820)
Genome map
AA seq 240 aa AA seqDB search
MRTPRCAIVWCMQARPDGPPAFTKPDAIDPALRAISRILPRGYGLHRGLKLPRALMKLAG
ITGRLRDVPVVAVNDAVSVRSHRPAGLPDPGPALLWIHGGGTVMGSAAQEDQYCRKLSHL
AGVAVAAVDYRLAPEHPYPTPVEDCYAALLWLRQQQWVDPSRIAVAGASAGDLFAATLVQ
LACDRGDVEPVLQMLVYPMLDDRTGSGPNGHKRIMWSERDNQQAWQLYLAGADPSTAAPA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacctcgatgtgcaatcgtatggtgcatgcaagcccgtcccgatggtccgccg
gccttcaccaagcccgacgcaatcgaccccgccttgcgggcgatctcccggatcctgccg
cgaggctatgggttgcatcggggcctcaagctgccacgtgcgctgatgaagctggctggg
attactggacgtctgcgcgatgtgccggtggtggccgtcaacgacgcggtcagcgtgcga
tcgcaccggccagccggattgccggatccgggcccggccctgctctggatccacggcggc
ggaacggtcatgggcagcgccgctcaggaggatcagtactgccgcaagttgtctcatctg
gcgggcgtcgcggtggccgcggtggactaccggttggcgcccgagcacccctatccgacc
cccgtcgaggactgttatgcggcgttgctgtggctgcgccagcagcagtgggtcgatccg
tcgcggatcgcggtggccggtgccagtgccggcgatcttttcgcggccacgctggttcag
ctggcctgcgaccgtggtgatgtggaaccggtgctgcagatgttggtgtaccccatgctc
gacgaccgcaccggctccggtccgaacggccacaagcgcatcatgtggagcgagcgggac
aaccaacaggcgtggcagttgtatctggccggggcagaccccagcacggccgcaccggcg
tga

DBGET integrated database retrieval system