KEGG   Mycobacterium ulcerans: MUL_4340Help
Entry
MUL_4340          CDS       T00435                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
mul  Mycobacterium ulcerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABL06344
Pasteur: MUL_4340
UniProt: A0PVH5
LinkDB All DBs
Position
4815505..4816581
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPISPMLAKAVKTIPADASYEPKWDGFRSICFRDNDEVELGSRNERPLTRYFPE
LVAAVRAELPRRCVLDGEIVIATGHGLDFEALQQRIHHADSRVRMLAEHIPASFIAFDLL
ALGDDDYTTRPFVERRAALVEAVGSGPSIHVTPATTDQATARRWFEEFEGAGLDGVIAKP
LAVTYQPDKCVMFKLKHERTADCVLAGYRLHKSGGDVIGSLLLGLYQDDGQLASVGVIGA
FPMAERRRLFTELQELVTSFDDHPWNWAAHQSGERTPRKNEFSRWNAGKDLSFVPLRPER
VVEVRYDHMEGPRFRHTAQFNRWRPDRDPRSCTYAQLEQPLMFNLDDIVAGLGPRCGH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggacctaccagtcatgccgccgatttcgccgatgctggccaaggcggtcaagacgatc
ccggccgatgcgtcctatgaacccaaatgggatggattccgctccatctgttttcgcgac
aacgatgaggtagagctcggcagccgcaacgaacgtccgctgacccgttacttcccggag
ctggtcgcggcggtccgggcggagctgccgcggcgctgcgtccttgacggcgagatcgtg
atcgccaccggccacggcctggatttcgaggcgctgcaacagcgcatccaccacgccgat
tcccgggtgcggatgctcgccgaacacatcccggcatccttcatcgccttcgacctgctg
gccctcggcgacgacgactacacgacgcgtccatttgtggaacggcgcgcggcgctggtc
gaggcggtcggctccggcccatcgatccatgtcaccccggccaccaccgatcaggcgacg
gcacggcggtggttcgaagagttcgagggcgccggcctcgacggagtgatcgccaaaccg
ctggcggtcacctatcagccggacaagtgcgtgatgttcaagctcaagcacgaacgcacc
gccgactgcgtgctggccggatatcgcctccacaaatccggcggtgacgtcatcggttcg
ctattgctgggcctctaccaagacgacgggcaattggcgtcggtcggcgtgatcggggca
ttcccgatggccgaacgccggcggctcttcaccgagctgcaggagctggtgaccagcttc
gacgaccatccgtggaactgggccgcccaccagtccggcgaacgcacgccacgcaaaaac
gagttctcccgctggaacgccggcaaagacctctcgtttgtgccgctgcgccccgaacgc
gtggtcgaggtgcgctacgaccacatggagggcccacggttccgtcacaccgcccagttc
aaccggtggcgtcccgaccgcgatccacgttcctgcacctacgcccagctcgagcaaccg
ctgatgttcaatctcgacgacatcgttgctggtctcggaccccgctgcgggcactag

DBGET integrated database retrieval system