KEGG   Mycobacterium ulcerans: MUL_4349Help
Entry
MUL_4349          CDS       T00435                                 

Gene name
fadD15_1
Definition
(GenBank) long-chain-fatty-acid-CoA ligase FadD15_1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00061  Fatty acid biosynthesis
mul00071  Fatty acid degradation
mul01100  Metabolic pathways
mul01212  Fatty acid metabolism
mul02024  Quorum sensing
Module
mul_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mul00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MUL_4349 (fadD15_1)
   00071 Fatty acid degradation
    MUL_4349 (fadD15_1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MUL_4349 (fadD15_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mul01004]
    MUL_4349 (fadD15_1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mul04147]
    MUL_4349 (fadD15_1)
Enzymes [BR:mul01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     MUL_4349 (fadD15_1)
Lipid biosynthesis proteins [BR:mul01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   MUL_4349 (fadD15_1)
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   MUL_4349 (fadD15_1)
  Exosomal proteins of breast cancer cells
   MUL_4349 (fadD15_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABL06351
Pasteur: MUL_4349
UniProt: A0PVI2
LinkDB All DBs
Position
complement(4824127..4825929)
Genome map
AA seq 600 aa AA seqDB search
MREWDVPADFTVTAEDNVASCVYTHERDDPDHVIFQRFVDGTWTDVTCAQAAQQIRAAAL
GLIAEGVNAGDRVAILSATRYEWVILDYAILSVGAVTVPIYDTSSAEQVRWVLEDSGAVL
AVAETDAHAQLIKQLSDELPSLRKILHLDSDGPAALDELAEAGKSVARDQLYDRLAALRS
SDPATLIYTSGTTGRPKGCQLTHSNLLYEARGAASCFPTLLRKGERLLVFLPLAHVLARS
LSMSAFANKVTIGYTGDIKNLVATLGVFKPTVVVSVPRVFEKVYNTAELKARDSGRGMIF
DVAVATAIAWSKALDTGGAGLLLRARHALFDRLVYEKLRSALGGDCHAAVSGGAPLDTRL
CHFYRGIGLTIYEGYGLTETSAAITANRIGQERVGTVGNLLPGNSMAIAEDGEVLVRGGV
VFTGYWHNEKATAEAIVDGWFHTGDLGSVDDAGFLSIVGRKKEIIVTAGGKNVAPAILED
QLRAHPLISQAMVVGDNRPFVVALIAIDPEGFEVWKQRHSKAAAASVADLIDDPDLTAEI
DQAVKQANQVVSQAESIRKFCILPVDFTVLTGELTPTLKVKRNVVAERFAGEIDSLSRKQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaatgggatgttcccgcggatttcaccgttaccgcagaggacaacgtcgccagc
tgcgtgtacacgcatgagcgagacgacccagatcatgtgatctttcagcggtttgtcgac
ggcacctggacggacgtgacctgcgcccaggccgcccagcagatccgggccgccgcactg
ggtttgatcgccgagggggtcaatgccggcgatcgggtggccatcttgtcggccactcgc
tacgagtgggtgatcctcgactacgcgatcctctcggtcggggcggtgaccgtgccgatc
tacgacacgtcttcggctgagcaagtgcgctgggtcctggaggattcgggggcggtattg
gcggtcgccgagaccgatgcccatgcccagctgatcaagcaactcagcgatgagttgccc
agcttgcgcaagatcttgcacctcgactccgatgggcccgcggcgctcgacgagctcgcc
gaggcagggaaatcggtagcccgcgaccaactctacgaccggctggcagcgctgcggtcc
tccgacccggcgacactgatctatacctcgggcaccaccgggcgcccgaagggctgtcag
ctgacccactccaatctgctctacgaagcgcgcggcgcggcgtcatgctttccgacgctg
ttgcgcaagggcgagcgactgctggtatttctgccgctggcccatgtgctggcccggtcg
ctgtcgatgtctgcgttcgccaacaaagtcaccatcggctacaccggcgacatcaagaac
ctggtggcgacgctgggcgtcttcaagccgacggtcgtggtatcggtgccccgggtattc
gaaaaggtctacaacacagccgagttgaaggctcgcgacagcggccgcggcatgatcttc
gatgtcgccgtcgcaaccgcgatcgcctggagtaaggcgctggacaccggcggcgcaggc
ctgttgctgcgggcccggcatgcactgtttgatcggctggtgtacgagaagctgcgctcg
gcgctgggcggcgattgtcacgccgccgtctccgggggagcgccgctggacacccggttg
tgtcacttctaccgcggcatcgggctgacgatctacgagggctacggactgaccgaaacc
agcgctgccatcaccgccaaccggatcggtcaagagcgagtgggcacggtcggaaacctg
ttgcccggcaacagcatggcgatcgccgaggacggcgaggtgctggtccgcggcggggtg
gtgttcaccggctattggcacaacgagaaggccaccgccgaggcgatcgtcgatgggtgg
ttccacaccggtgacctggggtcggtcgacgacgccggattcttgtcgatcgtcggtcgc
aagaaggagatcatcgtgaccgccggcggcaagaacgtggcaccggcgatcctcgaagac
cagctgcgggcgcacccgctgatcagccaggcgatggtggtcggggacaaccggcccttc
gtcgtcgcgctgatcgccatcgatccggaaggcttcgaggtctggaagcagcgccacagc
aaggccgccgccgcctcggttgcggacctcatcgatgaccccgacctcaccgccgagatc
gatcaggccgtcaaacaggctaatcaggtggtctcccaagcggaatcaatccgcaagttc
tgcatcctgccggtggacttcaccgtcctcaccggtgagctgacccccacgctgaaggtg
aagcgcaacgtggtcgccgaacgattcgccggcgagatcgattcgctctcccgcaagcag
tga

DBGET integrated database retrieval system