KEGG   Mycobacterium ulcerans: MUL_4777Help
Entry
MUL_4777          CDS       T00435                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
Organism
mul  Mycobacterium ulcerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABL06694
Pasteur: MUL_4777
UniProt: A0PWH5
LinkDB All DBs
Position
5291954..5292997
Genome map
AA seq 347 aa AA seqDB search
MAATMRAERFYADSKTVVLEDVPIPEPGPGEVLVKVAYCGICHSDLSLINGTFPTQAPVV
TQGHEASGTIVKLGPEVDGWSEGDRVVVAAGRPCQSCPNCRRGDTVNCLRIQLMAFAYDG
AWAEYTVAQAAGLTRVPDNVSLDQAAILADAVSTPFGAVVRTGKVAVGESVGVWGVGGVG
THIVQLARLVGAVPVIALDINPVVLDRALELGADYAFDSRDDQLHDKLAEITGGRMLDVA
FDAVGLKATFEQALGSLTAGGRLVGVGTSAESPTVGPTSMFGLTHKQVLGHLGYQNVDIE
TLAKLVSLGRLDLSRSISEIVPLEDLSLGIEKLERQDGNPIRILVQP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcggccacgatgcgagccgagcgcttctacgccgattccaaaacagttgtactcgaa
gatgttccgataccggagccggggccgggcgaggtcctggtcaaagtggcctactgcggg
atctgccactccgatctgagtctgatcaacggcaccttccccacccaggcgccggtggtg
acccaggggcacgaggcgtcgggcaccatagtcaaactcggccccgaggttgacggctgg
tccgagggcgaccgcgtcgtggtggccgccggccggccgtgccagagctgcccgaactgc
cgacgcggtgacacggtgaattgcctgcggatccagctgatggcgttcgcctacgacggg
gcctgggcggagtacaccgtggcacaggcggccggtctgacccgggtgcccgacaatgtt
tcgctcgaccaagccgcgattctggccgatgcggtgtccacaccgttcggtgcggtggtg
cggaccggcaaagtggccgtcggggaatcggtcggggtgtggggcgtgggtggcgtcgga
acccacatcgtgcaactggcccgtttggtcggcgcggtgccggtgatcgccttggacatc
aatcccgtggtgctcgaccgggcgctggaactgggcgccgactacgccttcgactcccgc
gacgaccaactgcacgacaagctcgccgagatcaccggcggccgcatgctcgacgtggcg
ttcgacgcggtcggtctcaaggccaccttcgagcaggcgctcggatcgctgaccgccgga
ggccggctggtcggtgttggcacgagtgccgaatcaccgaccgtgggacccacctcgatg
ttcggactgacccacaagcaggtactcggtcacctcggctaccagaacgtcgatatcgaa
accctggcgaagctggtttcacttgggcgcctggatctttcgcgctccatcagcgagatc
gtcccgcttgaagacctgtcgttgggtatcgagaagctggaacgccaggacggcaacccg
atccgcatcctggtccagccctga

DBGET integrated database retrieval system