KEGG   Massilia umbonata: FCL38_10735Help
Entry
FCL38_10735       CDS       T06138                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mum  Massilia umbonata
Pathway
mum00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FCL38_10735
Enzymes [BR:mum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     FCL38_10735
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     FCL38_10735
    1.1.1.-  
     FCL38_10735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: QCP10852
UniProt: A0A4P8HQK1
LinkDB All DBs
Position
2663348..2664457
Genome map
AA seq 369 aa AA seqDB search
MTDPQTDTSRTMRAAVWHGRHDIRVEAVPLPPPPPEGWVQIHVHWCGICGSDLHEYLAGP
VFIPVAAPHPLTGIQGQCILGHEFCGEIAAVGPGVHGFAVGERVAADACQHCGHCYYCTH
GMYNICEQLAFTGLMNNGAFAELVNVPAELLYKLPAGFPAEAGALIEPLAVGMHAVKKAG
SLLGRSVVVVGAGTIGLCTIACARAAGAAQVIALEMSAARKARATLVGASHVFDPSSCDA
LAEVRRVTNGLGADVSFECIGHRDTAKLAIDAIRKAGTAVLVGVFEEPSSFNFFELVATE
KQVIGSLAYNGEFADVIAFIADGRIDVAPFITGRIGLEDIVGEGFERLVRDKENNVKIIV
SPGLAAACA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgcaaaccgatacttcgcgcacaatgcgcgcggctgtctggcatggccgc
catgacatccgcgtcgaagccgtcccgctgccgccgccaccgcccgaagggtgggtgcag
atccacgtccactggtgcggcatctgcgggtccgatctccacgaatacctggccggtccc
gtgttcatccccgtcgccgcgccccatccgctgacgggtatccaggggcagtgcatcctg
gggcacgagttctgcggcgagatcgccgcggtcggccccggcgtgcacggcttcgccgtc
ggcgaacgggtggccgccgacgcgtgccagcattgcgggcactgctactactgcacgcat
ggcatgtacaacatctgcgagcaactcgccttcacgggactgatgaacaatggcgcgttc
gccgagctggtcaacgttccggccgagctgctctacaagctgccggccggctttcccgcc
gaagcgggcgccctgatcgaacccctcgccgtcggcatgcacgcggtgaaaaaggccggc
agcctgctcggacgcagtgtcgtcgtggtcggcgccggaacgatcggcctttgcacgatc
gcgtgcgcgcgcgccgccggcgccgcgcaggtgatcgccctggagatgtcggcggcgcgc
aaggcgcgcgccacgctggtcggcgccagccacgtgttcgacccgtcctcgtgcgacgcg
ctggccgaggtccgccgcgtcaccaatgggctgggcgcggacgtcagcttcgagtgcatc
ggccacagggacacggcgaagctggcgatcgacgcgatccgcaaggccggtaccgccgtg
ctggtcggcgtcttcgaggagccgagcagcttcaatttcttcgaactggtggccactgaa
aagcaggtgatcggctcgctggcctacaacggcgaattcgccgatgtgatcgccttcatc
gccgatggccgcatcgatgtggcgcccttcattaccggccgcatcgggctggaggacatc
gtcggcgaaggcttcgaacggctcgtccgcgacaaggaaaacaacgtcaagatcatcgtg
tcgcccggccttgccgcggcatgcgcgtag

DBGET integrated database retrieval system