KEGG   Massilia umbonata: FCL38_24745Help
Entry
FCL38_24745       CDS       T06138                                 

Definition
(GenBank) rod shape-determining protein
  KO
K03569  rod shape-determining protein MreB and related proteins
Organism
mum  Massilia umbonata
Brite
KEGG Orthology (KO) [BR:mum00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mum03036]
    FCL38_24745
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mum04812]
    FCL38_24745
   02048 Prokaryotic defense system [BR:mum02048]
    FCL38_24745
Chromosome and associated proteins [BR:mum03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    FCL38_24745
Cytoskeleton proteins [BR:mum04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actins
    FCL38_24745
Prokaryotic defense system [BR:mum02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    FCL38_24745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreB_Mbl HSP70 FtsA Actin PilM_2 EutA DDR Ppx-GppA
Motif
Other DBs
NCBI-ProteinID: QCP13279
UniProt: A0A4P8HTK3
LinkDB All DBs
Position
5891199..5892242
Genome map
AA seq 347 aa AA seqDB search
MFGFLRRYISSDLAIDLGTANTLIYVRGSGIVLDEPSVVAIRQEGGPNGKKTIQAVGKEA
KQMLGKVPGNIEAIRPMKDGVIADFTVTEQMLKQFIRMVHDSKFFRPSPRIIICVPCGST
QVERRAIRESALGAGASQVYLIEEPMAAAIGAGLPVSDATGSMVVDIGGGTTEVGIISLG
GMVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKAIGSAFPGSEVKEMEVKGR
NLSEGIPRSFTISSNEILEALTDPLNNIVSAVKNALEQTPPELGADIAEKGMMLTGGGAL
LRDLDRLLMEETGLPVLVAEDPLTCVVRGSGMALERMDQLGSIFSYE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttttttacgcaggtacatctcgtccgatctggctatcgatctcggcacggca
aataccctcatctacgttcgtggttcgggcatcgtgctcgatgagccctcggtagtggcg
atccgccaggaaggcggcccgaatggcaagaaaacgatacaggcggtaggcaaggaagcc
aagcagatgctgggcaaggtaccgggtaacatcgaagcgatccgcccgatgaaggatggc
gtgatcgccgacttcaccgtgaccgagcagatgctcaagcagttcatccgcatggtgcac
gactcgaaattcttccgcccgtcgccgcgcatcatcatctgcgtgccgtgcggttcgacc
caggtggaacgccgcgcgatccgcgaatcggcgctcggtgccggcgcttcgcaggtctac
ctgatcgaagaaccgatggccgcggcgatcggcgccggcctgccggtgtccgatgcaacg
ggctcgatggtggtcgacatcggcggcggcaccacggaagtgggcatcatttcgctgggt
ggcatggtctacaagggctcggtgcgcgtgggtggcgacaagttcgacgaagcgatcgtg
aactacatccgccgcaactacggcatgctgatcggcgaacagacggccgaggcgatcaag
aaggcgatcggctccgcgttccccggctccgaagtgaaggaaatggaagtcaagggccgc
aacctgtccgaaggcattccccgttcgttcacgatctcgtcgaacgagatcctggaagcg
ctgaccgacccgctgaacaatatcgtgtcggccgtgaagaacgcgctggagcagacgccg
ccggaactgggcgccgacatcgccgaaaaaggcatgatgctgacgggcggcggcgcgctg
ctgcgcgacctggatcgcctgctgatggaagaaaccggcctgccggtgctggtggccgag
gacccgctgacttgcgtggtgcgtggttcgggcatggcgctggaacgcatggaccagctg
ggctcgatcttctcttacgagtaa

DBGET integrated database retrieval system