KEGG   Meriones unguiculatus (Mongolian gerbil): 110539463
Entry
110539463         CDS       T05884                                 

Gene name
Il6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01523  Antifolate resistance
mun04060  Cytokine-cytokine receptor interaction
mun04061  Viral protein interaction with cytokine and cytokine receptor
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04218  Cellular senescence
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04640  Hematopoietic cell lineage
mun04657  IL-17 signaling pathway
mun04659  Th17 cell differentiation
mun04668  TNF signaling pathway
mun04672  Intestinal immune network for IgA production
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05010  Alzheimer disease
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05133  Pertussis
mun05134  Legionellosis
mun05135  Yersinia infection
mun05142  Chagas disease
mun05143  African trypanosomiasis
mun05144  Malaria
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05321  Inflammatory bowel disease
mun05323  Rheumatoid arthritis
mun05332  Graft-versus-host disease
mun05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110539463 (Il6)
   04668 TNF signaling pathway
    110539463 (Il6)
   04066 HIF-1 signaling pathway
    110539463 (Il6)
   04068 FoxO signaling pathway
    110539463 (Il6)
   04151 PI3K-Akt signaling pathway
    110539463 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110539463 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110539463 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110539463 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110539463 (Il6)
   04620 Toll-like receptor signaling pathway
    110539463 (Il6)
   04621 NOD-like receptor signaling pathway
    110539463 (Il6)
   04623 Cytosolic DNA-sensing pathway
    110539463 (Il6)
   04625 C-type lectin receptor signaling pathway
    110539463 (Il6)
   04659 Th17 cell differentiation
    110539463 (Il6)
   04657 IL-17 signaling pathway
    110539463 (Il6)
   04672 Intestinal immune network for IgA production
    110539463 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110539463 (Il6)
   05202 Transcriptional misregulation in cancer
    110539463 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110539463 (Il6)
   05321 Inflammatory bowel disease
    110539463 (Il6)
   05332 Graft-versus-host disease
    110539463 (Il6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110539463 (Il6)
   05020 Prion disease
    110539463 (Il6)
   05022 Pathways of neurodegeneration - multiple diseases
    110539463 (Il6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110539463 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110539463 (Il6)
   04931 Insulin resistance
    110539463 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110539463 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110539463 (Il6)
   05135 Yersinia infection
    110539463 (Il6)
   05133 Pertussis
    110539463 (Il6)
   05134 Legionellosis
    110539463 (Il6)
   05152 Tuberculosis
    110539463 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110539463 (Il6)
   05161 Hepatitis B
    110539463 (Il6)
   05171 Coronavirus disease - COVID-19
    110539463 (Il6)
   05164 Influenza A
    110539463 (Il6)
   05162 Measles
    110539463 (Il6)
   05168 Herpes simplex virus 1 infection
    110539463 (Il6)
   05163 Human cytomegalovirus infection
    110539463 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110539463 (Il6)
   05169 Epstein-Barr virus infection
    110539463 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110539463 (Il6)
   05144 Malaria
    110539463 (Il6)
   05142 Chagas disease
    110539463 (Il6)
   05143 African trypanosomiasis
    110539463 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110539463 (Il6)
   01523 Antifolate resistance
    110539463 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110539463 (Il6)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interleukins
   110539463 (Il6)
SSDB
Motif
Pfam: IL6 IL23 DUF1137
Other DBs
NCBI-GeneID: 110539463
NCBI-ProteinID: XP_021481994
LinkDB
Position
Unknown
AA seq 212 aa
MKFLSARDFQALAFLGLMVVMATAFPTSQVRRGDFTEDTTPNRPVYTTSQQVRGLITYVL
SEILETRKQLCNDNPDCMNKENALSENNLKLPEIQRDDGCFHTGYNRDVCLLKITSGLLE
YQTYLEYVKNNLQDNKKDKARAIQSNTKTLIRIFKQEVKDPGQIVFPDPTSEALLLEKLE
SQTEWLKSKTTQLILTALEEFLKVTKRFTLQN
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaagttcctctccgcaagagacttccaagcacttgccttcttggggctgatggtggtg
atggccactgccttccctacttcacaagtccggagaggagacttcacagaggacaccacc
cccaacagaccagtatacaccacttcacaacaagtcagaggcctgattacatatgttctc
agtgaaatcttggaaacgagaaaacagttgtgtaatgacaatcctgactgtatgaacaag
gaaaatgcattgtcagaaaacaatctgaaacttccagagatacagagagatgatggatgc
ttccatactggatacaatcgggacgtttgcctattgaaaatcacctctggtcttctggag
taccagacatatctggagtatgtgaagaacaacttacaagataacaagaaagacaaagcc
agagccattcagagcaacaccaaaaccctaattcgtatcttcaaacaagaggtgaaggat
ccaggtcaaatagtctttcctgacccaacttccgaggcgctcctactggagaaactggag
tcacagacggaatggctgaagtccaagaccacccagctcatcctgacagcacttgaagaa
ttcctcaaggtcaccaagaggtttactttgcaaaactag

DBGET integrated database retrieval system