KEGG   Meriones unguiculatus (Mongolian gerbil): 110539607
Entry
110539607         CDS       T05884                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04015  Rap1 signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04071  Sphingolipid signaling pathway
mun04261  Adrenergic signaling in cardiomyocytes
mun04360  Axon guidance
mun04371  Apelin signaling pathway
mun04540  Gap junction
mun04611  Platelet activation
mun04670  Leukocyte transendothelial migration
mun04713  Circadian entrainment
mun04723  Retrograde endocannabinoid signaling
mun04724  Glutamatergic synapse
mun04725  Cholinergic synapse
mun04726  Serotonergic synapse
mun04727  GABAergic synapse
mun04728  Dopaminergic synapse
mun04730  Long-term depression
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04916  Melanogenesis
mun04921  Oxytocin signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04924  Renin secretion
mun04926  Relaxin signaling pathway
mun04928  Parathyroid hormone synthesis, secretion and action
mun04934  Cushing syndrome
mun04935  Growth hormone synthesis, secretion and action
mun04971  Gastric acid secretion
mun05012  Parkinson disease
mun05030  Cocaine addiction
mun05032  Morphine addiction
mun05034  Alcoholism
mun05133  Pertussis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05163  Human cytomegalovirus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110539607
   04371 Apelin signaling pathway
    110539607
   04071 Sphingolipid signaling pathway
    110539607
   04024 cAMP signaling pathway
    110539607
   04022 cGMP-PKG signaling pathway
    110539607
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110539607
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110539607
   04670 Leukocyte transendothelial migration
    110539607
   04062 Chemokine signaling pathway
    110539607
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110539607
   04915 Estrogen signaling pathway
    110539607
   04914 Progesterone-mediated oocyte maturation
    110539607
   04921 Oxytocin signaling pathway
    110539607
   04926 Relaxin signaling pathway
    110539607
   04935 Growth hormone synthesis, secretion and action
    110539607
   04928 Parathyroid hormone synthesis, secretion and action
    110539607
   04916 Melanogenesis
    110539607
   04924 Renin secretion
    110539607
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110539607
  09154 Digestive system
   04971 Gastric acid secretion
    110539607
  09156 Nervous system
   04724 Glutamatergic synapse
    110539607
   04727 GABAergic synapse
    110539607
   04725 Cholinergic synapse
    110539607
   04728 Dopaminergic synapse
    110539607
   04726 Serotonergic synapse
    110539607
   04730 Long-term depression
    110539607
   04723 Retrograde endocannabinoid signaling
    110539607
  09158 Development and regeneration
   04360 Axon guidance
    110539607
  09159 Environmental adaptation
   04713 Circadian entrainment
    110539607
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110539607
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110539607
  09165 Substance dependence
   05030 Cocaine addiction
    110539607
   05032 Morphine addiction
    110539607
   05034 Alcoholism
    110539607
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110539607
  09171 Infectious disease: bacterial
   05133 Pertussis
    110539607
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110539607
   05163 Human cytomegalovirus infection
    110539607
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110539607
   05142 Chagas disease
    110539607
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110539607
   04031 GTP-binding proteins [BR:mun04031]
    110539607
Exosome [BR:mun04147]
 Exosomal proteins
  Proteins found in most exosomes
   110539607
GTP-binding proteins [BR:mun04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    110539607
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 110539607
NCBI-ProteinID: XP_021482128
LinkDB
Position
Unknown
AA seq 291 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYA
NT seq 874 nt   +upstreamnt  +downstreamnt
atgggctgcaccctgagcgccgaggacaaggcggccgtggagcgcagcaagatgatcgac
cgcaacctccgggaggacggcgagaaggcggcgcgcgaggtcaagctgctgctgctgggt
gctggtgaatctggaaaaagtaccattgtgaagcagatgaaaattatccacgaggctggt
tactcagaagaggagtgtaagcagtacaaggcggtggtctacagcaacaccatccagtcc
atcattgccatcattagggccatgggaaggttgaaaatagactttggagactctgctcgg
gcggatgatgctcgccaactctttgtgcttgctggggctgcagaagaaggctttatgact
gcagagcttgctggagtcataaagagattatggaaagacagtggtgtgcaagcctgcttc
aacagatcccgggagtaccagctgaacgattctgccgcatattatttgaatgacttggac
agaatagcacaaccaaattacatcccaactcagcaagatgttctcagaaccagggtgaaa
acgacaggaattgtggaaacccattttactttcaaggaccttcattttaaaatgttcgat
gtgggcggtcagaggtcagaacggaagaagtggattcactgctttgaaggagtaaccgcc
atcatcttctgtgtggccctgagtgactatgacctggttttagctgaagatgaagaaatg
aatcggatgcacgaaagcatgaaattgttcgacagtatatgcaacaacaaatggtttacg
gatacatctattatactttttctaaacaagaaggacctctttgaagaaaaaatcaaaaag
agtcctctcacgatatgctatccagaatatgcag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110545517
Entry
110545517         CDS       T05884                                 

Gene name
Gnai3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04015  Rap1 signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04071  Sphingolipid signaling pathway
mun04261  Adrenergic signaling in cardiomyocytes
mun04360  Axon guidance
mun04371  Apelin signaling pathway
mun04540  Gap junction
mun04611  Platelet activation
mun04670  Leukocyte transendothelial migration
mun04713  Circadian entrainment
mun04723  Retrograde endocannabinoid signaling
mun04724  Glutamatergic synapse
mun04725  Cholinergic synapse
mun04726  Serotonergic synapse
mun04727  GABAergic synapse
mun04728  Dopaminergic synapse
mun04730  Long-term depression
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04916  Melanogenesis
mun04921  Oxytocin signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04924  Renin secretion
mun04926  Relaxin signaling pathway
mun04928  Parathyroid hormone synthesis, secretion and action
mun04934  Cushing syndrome
mun04935  Growth hormone synthesis, secretion and action
mun04971  Gastric acid secretion
mun05012  Parkinson disease
mun05030  Cocaine addiction
mun05032  Morphine addiction
mun05034  Alcoholism
mun05133  Pertussis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05163  Human cytomegalovirus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110545517 (Gnai3)
   04371 Apelin signaling pathway
    110545517 (Gnai3)
   04071 Sphingolipid signaling pathway
    110545517 (Gnai3)
   04024 cAMP signaling pathway
    110545517 (Gnai3)
   04022 cGMP-PKG signaling pathway
    110545517 (Gnai3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110545517 (Gnai3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110545517 (Gnai3)
   04670 Leukocyte transendothelial migration
    110545517 (Gnai3)
   04062 Chemokine signaling pathway
    110545517 (Gnai3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110545517 (Gnai3)
   04915 Estrogen signaling pathway
    110545517 (Gnai3)
   04914 Progesterone-mediated oocyte maturation
    110545517 (Gnai3)
   04921 Oxytocin signaling pathway
    110545517 (Gnai3)
   04926 Relaxin signaling pathway
    110545517 (Gnai3)
   04935 Growth hormone synthesis, secretion and action
    110545517 (Gnai3)
   04928 Parathyroid hormone synthesis, secretion and action
    110545517 (Gnai3)
   04916 Melanogenesis
    110545517 (Gnai3)
   04924 Renin secretion
    110545517 (Gnai3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110545517 (Gnai3)
  09154 Digestive system
   04971 Gastric acid secretion
    110545517 (Gnai3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110545517 (Gnai3)
   04727 GABAergic synapse
    110545517 (Gnai3)
   04725 Cholinergic synapse
    110545517 (Gnai3)
   04728 Dopaminergic synapse
    110545517 (Gnai3)
   04726 Serotonergic synapse
    110545517 (Gnai3)
   04730 Long-term depression
    110545517 (Gnai3)
   04723 Retrograde endocannabinoid signaling
    110545517 (Gnai3)
  09158 Development and regeneration
   04360 Axon guidance
    110545517 (Gnai3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110545517 (Gnai3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110545517 (Gnai3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110545517 (Gnai3)
  09165 Substance dependence
   05030 Cocaine addiction
    110545517 (Gnai3)
   05032 Morphine addiction
    110545517 (Gnai3)
   05034 Alcoholism
    110545517 (Gnai3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110545517 (Gnai3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110545517 (Gnai3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110545517 (Gnai3)
   05163 Human cytomegalovirus infection
    110545517 (Gnai3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110545517 (Gnai3)
   05142 Chagas disease
    110545517 (Gnai3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110545517 (Gnai3)
   04031 GTP-binding proteins [BR:mun04031]
    110545517 (Gnai3)
Exosome [BR:mun04147]
 Exosomal proteins
  Proteins found in most exosomes
   110545517 (Gnai3)
GTP-binding proteins [BR:mun04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    110545517 (Gnai3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 110545517
NCBI-ProteinID: XP_021487355
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
SELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggggagaaggcggccaaagaagtgaagctgctgctgctcggt
gctggagaatctggtaaaagtaccatcgtgaaacagatgaaaatcattcatgaggatggc
tattcagaagacgagtgtaaacagtataaagtagttgtctacagcaacaccattcagtcc
atcattgcaatcataagagccatgggacgcctaaagattgattttggggaagctgccaga
gcagacgatgcccggcagttatttgttttagctggcagtgccgaagaaggagtcatgact
tcagaactagcgggtgtgattaaacggttatggcgagatggtggggtgcaagcgtgcttc
agcaggtccagggaatatcagctcaatgattctgcttcatattacctaaatgatttggat
agaatatcccagaccaactacattccaactcaacaagacgtgcttcggacaagagtgaag
actacaggcattgtggagacacacttcaccttcaaggagctatacttcaaaatgtttgat
gtaggtggccaaagatcagaacgaaaaaaatggattcactgttttgagggagtgacagca
attatcttttgtgtggccctcagtgattatgaccttgttctggccgaggatgaggaaatg
aaccgaatgcacgaaagcatgaaattgtttgacagcatttgtaacaacaaatggtttaca
gatacttcaatcattctctttcttaataagaaagacctttttgaggagaaaataaagagg
agtccattaacaatctgttatccagaatacacaggttccaacacatacgaagaggcagct
gcttatattcagtgccagtttgaagatctgaaccgaagaaaagataccaaggagatctac
actcacttcacttgtgccacagacaccaaaaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtgggctttattga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110564775
Entry
110564775         CDS       T05884                                 

Gene name
Gnai2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04015  Rap1 signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04071  Sphingolipid signaling pathway
mun04261  Adrenergic signaling in cardiomyocytes
mun04360  Axon guidance
mun04371  Apelin signaling pathway
mun04540  Gap junction
mun04611  Platelet activation
mun04670  Leukocyte transendothelial migration
mun04713  Circadian entrainment
mun04723  Retrograde endocannabinoid signaling
mun04724  Glutamatergic synapse
mun04725  Cholinergic synapse
mun04726  Serotonergic synapse
mun04727  GABAergic synapse
mun04728  Dopaminergic synapse
mun04730  Long-term depression
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04916  Melanogenesis
mun04921  Oxytocin signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04924  Renin secretion
mun04926  Relaxin signaling pathway
mun04928  Parathyroid hormone synthesis, secretion and action
mun04934  Cushing syndrome
mun04935  Growth hormone synthesis, secretion and action
mun04971  Gastric acid secretion
mun05012  Parkinson disease
mun05030  Cocaine addiction
mun05032  Morphine addiction
mun05034  Alcoholism
mun05133  Pertussis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05163  Human cytomegalovirus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110564775 (Gnai2)
   04371 Apelin signaling pathway
    110564775 (Gnai2)
   04071 Sphingolipid signaling pathway
    110564775 (Gnai2)
   04024 cAMP signaling pathway
    110564775 (Gnai2)
   04022 cGMP-PKG signaling pathway
    110564775 (Gnai2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110564775 (Gnai2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110564775 (Gnai2)
   04670 Leukocyte transendothelial migration
    110564775 (Gnai2)
   04062 Chemokine signaling pathway
    110564775 (Gnai2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110564775 (Gnai2)
   04915 Estrogen signaling pathway
    110564775 (Gnai2)
   04914 Progesterone-mediated oocyte maturation
    110564775 (Gnai2)
   04921 Oxytocin signaling pathway
    110564775 (Gnai2)
   04926 Relaxin signaling pathway
    110564775 (Gnai2)
   04935 Growth hormone synthesis, secretion and action
    110564775 (Gnai2)
   04928 Parathyroid hormone synthesis, secretion and action
    110564775 (Gnai2)
   04916 Melanogenesis
    110564775 (Gnai2)
   04924 Renin secretion
    110564775 (Gnai2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110564775 (Gnai2)
  09154 Digestive system
   04971 Gastric acid secretion
    110564775 (Gnai2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110564775 (Gnai2)
   04727 GABAergic synapse
    110564775 (Gnai2)
   04725 Cholinergic synapse
    110564775 (Gnai2)
   04728 Dopaminergic synapse
    110564775 (Gnai2)
   04726 Serotonergic synapse
    110564775 (Gnai2)
   04730 Long-term depression
    110564775 (Gnai2)
   04723 Retrograde endocannabinoid signaling
    110564775 (Gnai2)
  09158 Development and regeneration
   04360 Axon guidance
    110564775 (Gnai2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110564775 (Gnai2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110564775 (Gnai2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110564775 (Gnai2)
  09165 Substance dependence
   05030 Cocaine addiction
    110564775 (Gnai2)
   05032 Morphine addiction
    110564775 (Gnai2)
   05034 Alcoholism
    110564775 (Gnai2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110564775 (Gnai2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110564775 (Gnai2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110564775 (Gnai2)
   05163 Human cytomegalovirus infection
    110564775 (Gnai2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110564775 (Gnai2)
   05142 Chagas disease
    110564775 (Gnai2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110564775 (Gnai2)
   04031 GTP-binding proteins [BR:mun04031]
    110564775 (Gnai2)
Exosome [BR:mun04147]
 Exosomal proteins
  Proteins found in most exosomes
   110564775 (Gnai2)
GTP-binding proteins [BR:mun04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    110564775 (Gnai2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 110564775
NCBI-ProteinID: XP_021517971
LinkDB
Position
Unknown
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGML
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSEYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcagccgagcgctctaagatgatcgac
aagaacctgcgggaggacggcgagaaggcggcgcgggaggtgaagttgcttctgttaggt
gctggggaatcggggaagagcaccattgtcaagcagatgaagatcatccatgaagatggc
tattcggaggaagagtgcaggcagtaccgtgcggttgtctacagcaacaccatccagtct
ataatggccatcgtcaaggccatgggcaacctgcagattgattttgccgacccccagcgc
gcggatgatgccaggcagctgtttgcactgtcctgtgctgctgaggaacaaggtatgctt
cctgaagacctgtccggtgtcatccggagactctgggctgaccatggtgtgcaagcctgc
tttggccgatcacgggaataccagcttaacgactcagccgcttactacctgaatgacctg
gagcggatcgcacagagtgagtacatccctacgcaacaggatgtgctgcgcacccgtgtg
aaaaccacgggcatcgtggagacacacttcaccttcaaggacttgcacttcaagatgttc
gacgtgggtggtcagcgatctgagcgcaagaagtggatccactgcttcgagggcgtcaca
gccatcatcttctgcgttgccttgagcgcctatgacttggtgctggctgaggacgaggag
atgaaccgcatgcatgagagcatgaagctgttcgacagcatctgcaacaacaagtggttc
accgacacctccatcatcctcttcctcaacaagaaggacctgtttgaagagaagatcaca
cagagccccctgaccatctgtttcccggagtacacaggggccaacaagtatgacgaggca
gccagctacatccagagcaagttcgaggacctgaataaacgcaaagacaccaaggagata
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagtttgtgtttgatgccgtc
actgacgtcatcatcaagaacaacctgaaggactgtggcctcttctga

DBGET integrated database retrieval system