KEGG   Meriones unguiculatus (Mongolian gerbil): 110540060
Entry
110540060         CDS       T05884                                 

Definition
(RefSeq) apoptotic protease-activating factor 1-like
  KO
K02084  apoptotic protease-activating factor
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04115  p53 signaling pathway
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05014  Amyotrophic lateral sclerosis
mun05016  Huntington disease
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05134  Legionellosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110540060
   04215 Apoptosis - multiple species
    110540060
   04115 p53 signaling pathway
    110540060
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110540060
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110540060
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110540060
   05012 Parkinson disease
    110540060
   05014 Amyotrophic lateral sclerosis
    110540060
   05016 Huntington disease
    110540060
   05020 Prion disease
    110540060
   05022 Pathways of neurodegeneration - multiple diseases
    110540060
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110540060
   05152 Tuberculosis
    110540060
  09172 Infectious disease: viral
   05161 Hepatitis B
    110540060
   05160 Hepatitis C
    110540060
   05164 Influenza A
    110540060
   05162 Measles
    110540060
   05168 Herpes simplex virus 1 infection
    110540060
   05169 Epstein-Barr virus infection
    110540060
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110540060
SSDB
Motif
Pfam: NB-ARC CARD CARD_2 AAA_16 ATPase_2 AAA_22
Other DBs
NCBI-GeneID: 110540060
NCBI-ProteinID: XP_021482560
LinkDB
Position
Unknown
AA seq 271 aa
MDAKARNCLLQHREALEKDIKTSYIMDHMISNGVLTVGEEEKVKIQATQSQRAATLIKMI
LNKDNCAYISFYNALLHEGYKDLAALLHSGLPLVSSSSGKDTDGGITSFVRTVLCEGGVP
QRPVIFVTRKKLVNAIQQKLWKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCSRLDQEESFSQRLPLNIEEAKDRLRVLMLRKHPRYPS
NGVSVGDFTDTLRHHAFLLEPLPSCSSLLGF
NT seq 816 nt   +upstreamnt  +downstreamnt
atggatgcaaaggcccggaactgtttgcttcaacatagagaagctctggaaaaggacatc
aaaacatcctacatcatggaccatatgatcagtaatggcgttttaacagtaggagaggag
gaaaaagtgaaaatccaggccactcaatctcagcgagcagctactttaattaaaatgata
cttaataaagataactgtgcctacatttcattctacaatgctctgctacatgagggatat
aaagaccttgctgcgcttcttcacagtggccttcctcttgtttcttcttccagtggcaaa
gacacagacggtggaataacctcgtttgtaaggacagtgctgtgtgaaggtggagtccca
cagaggccagttatttttgttactaggaagaagctggttaatgcaattcagcagaagctg
tggaaactgaatggtgaaccagggtgggttaccatctatggaatggcaggctgtgggaag
tcggtattagctgcggaagctgttcgagatcattccctcttggaaggttgtttcccaggg
ggtgtacattgggtttcagttggaaaacaagataaatctgggcttctcatgaaactgcag
aatctttgctcacggctggatcaagaagagagtttttcgcagaggcttccacttaatatt
gaagaggcgaaagaccgtctccgtgtcctgatgctacgcaaacacccaaggtatccatca
aacggagttagtgtgggagactttactgacaccctgagacaccatgcctttctcctagag
ccattgccttcctgctcttccctcttaggattttaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110541243
Entry
110541243         CDS       T05884                                 

Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04115  p53 signaling pathway
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05014  Amyotrophic lateral sclerosis
mun05016  Huntington disease
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05134  Legionellosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110541243
   04215 Apoptosis - multiple species
    110541243
   04115 p53 signaling pathway
    110541243
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110541243
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110541243
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110541243
   05012 Parkinson disease
    110541243
   05014 Amyotrophic lateral sclerosis
    110541243
   05016 Huntington disease
    110541243
   05020 Prion disease
    110541243
   05022 Pathways of neurodegeneration - multiple diseases
    110541243
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110541243
   05152 Tuberculosis
    110541243
  09172 Infectious disease: viral
   05161 Hepatitis B
    110541243
   05160 Hepatitis C
    110541243
   05164 Influenza A
    110541243
   05162 Measles
    110541243
   05168 Herpes simplex virus 1 infection
    110541243
   05169 Epstein-Barr virus infection
    110541243
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110541243
SSDB
Motif
Pfam: WD40 APAF1_C ANAPC4_WD40 Ge1_WD40 eIF2A WD40_like Nup160 TFIIIC_delta
Other DBs
NCBI-GeneID: 110541243
NCBI-ProteinID: XP_021483704
LinkDB
Position
Unknown
AA seq 750 aa
ELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVCENFQEFLSLNGHLLGRQ
PFPNIVQLGLCEPETSEVYQQAKLRAKQEVDTGQLYLEWINKKTIKNLSRLVVRPHTDAV
YHACFSQDGQRIASCGADKTLQVFKAETGEKLLDIKAHDDEVLCCAFSSDDSHIATCSVD
KKVKIWDSVTGKLVHIYDEHSEQVNCCHFTNKSNHLLATGSSDFFLKLWDLNQKQCRNTM
FGHTNSVNHCRFSPDDELLASCSADGTLKLWDVRSANERKSINVKRFFLSSEDPQEEVEV
IVQCCSWSADGAQIIVAAKNRVLLFDIHTSDLLAEIHTGHQSTIQYCDFSPYDHLAVVAL
SQYCVELWNVESRLKVADCRGHLSWVHGVMFSPDGSSFLTASDDQTIRVWETKKVCKNSA
TVLNQEIDVVFQENEMMVLAVDNIRGLQLIAGKTGQIDYLPEAQVSCCCLSPHLEYVAFG
DEDGAIKVIELPNNRVFGSKIGHRKAVRHIQFTADGKTLISSSEDSVIQVWNWQSEDFVF
LEAHQETVKDFRLLKDSRLLSWSFDGTVKVWNIITGRIEKDFICHQGTVLSCDISSDAAK
FSSTSADKTAKIWSFEFLSPLHELKGHNGCVRCSAFSLDGILLATGDDNGEVRIWNVSSG
QLLHLCAPISVEEGTATHGGWVTDLCFSPDSKILVSAGGYLKWWNVVTGESSQTFYTNGT
NLKKIHVSPDFRTYVTVDNLGILYILQVLE
NT seq 2253 nt   +upstreamnt  +downstreamnt
gaactttgtgctttaatgttttccctggattggattaaagcaaagacggaacttgtcggc
cctgcccatctgattcatgagtttgtggaatataggcatatcttggatgaaaaggattgt
gcagtctgtgagaattttcaagagtttttatctttaaatggacaccttcttggacgacag
ccatttcctaatattgtccagttgggcctctgtgaaccagaaacttccgaagtttatcaa
caagcaaagcttcgggccaagcaggaggtggacactgggcagctctacctggaatggata
aacaaaaaaactatcaagaatctctcccgcctagttgtccgcccccatacagatgctgtt
taccacgcatgtttttctcaggacggtcagagaatagcctcttgtggagctgataaaacc
ttacaggtgttcaaagctgagacaggagagaaacttcttgacatcaaagctcacgacgat
gaagtgctttgctgcgcattctcttcagatgacagtcacatagcaacctgctcagtggat
aagaaagttaagatttgggattctgtgaccgggaagctagtacacatttatgacgagcac
tcagaacaagtcaattgctgccatttcaccaacaagagtaatcacctcttggctactggg
tcaagtgacttcttcctcaaactctgggacttgaatcagaaacaatgtcgaaataccatg
tttggtcacacaaactcagtcaatcactgcagattttcaccagacgatgagctcttggct
agttgctcagctgatgggacattaaagctttgggatgtgagatcagcaaacgagaggaag
agcattaatgtgaagcggttcttcctgagttcagaagaccctcaggaggaggtggaagtc
atcgtgcagtgctgctcctggtctgcagatggcgcccaaataatagtggcagcgaaaaac
agagtcctcctttttgatattcatactagtgacctgttggcagaaattcatacaggacat
cagagcaccatccaatactgtgacttctccccctatgaccatttggcagtggttgccctg
tcccagtactgtgtagagttgtggaatgtagagtcacgcttaaaggtagctgattgcaga
ggacatttgagttgggttcatggtgtgatgttttctcctgatggttcatcatttttgaca
gcttctgacgaccaaacaataagggtctgggagacaaaaaaggtgtgcaagaactctgcc
acagtgttaaaccaggaaatagatgttgtgtttcaagaaaatgaaatgatggtcttggca
gttgacaacataagaggtctacaactcattgctgggaagacaggccagattgattacctg
cctgaagctcaagtcagctgttgctgcctgagtccacatcttgagtatgttgcatttgga
gatgaggatggagccattaaggttatagaacttccaaacaacagagttttcggctctaag
attggccacaggaaggctgtgcggcacatccagttcacggctgacgggaagacactcatt
tcaagctctgaggactctgtgatccaggtatggaattggcagtcagaggactttgtcttt
ttggaagcccatcaggaaacagtgaaggactttaggctcttaaaagattcaagattactg
tcttggtcatttgatggaacagtgaaggtatggaatatcattactggaagaatagaaaaa
gacttcatttgtcaccagggtacagtactttcttgtgatatttcttctgatgctgccaag
ttttcatctacctctgctgataagactgcaaagatatggagttttgaattcctttcaccc
cttcatgagttgaagggccataatggctgtgtccgatgctctgccttctcactggatggc
atcctgctggcaactggagatgacaatggagaagtcaggatctggaatgtctccagtggc
cagcttcttcatttatgtgctccgatttcagtagaagaaggaactgctacccatggaggc
tgggtgaccgatctttgcttctctcctgacagtaaaatacttgtctctgcgggaggatat
cttaagtggtggaatgttgtcaccggggagtcctcacagaccttctacacaaatggaaca
aacctcaagaaaatacatgtgtcccctgacttcagaacatatgtgactgttgataatctt
ggtattttatacattttacaggttttagagtaa

DBGET integrated database retrieval system