KEGG   Meriones unguiculatus (Mongolian gerbil): 110540486
Entry
110540486         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-1 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110540486
   00053 Ascorbate and aldarate metabolism
    110540486
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110540486
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110540486
   00860 Porphyrin and chlorophyll metabolism
    110540486
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110540486
   00982 Drug metabolism - cytochrome P450
    110540486
   00983 Drug metabolism - other enzymes
    110540486
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110540486
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110540486
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110540486
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110540486
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110540486
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 110540486
NCBI-ProteinID: XP_021482930
LinkDB
Position
Unknown
AA seq 535 aa
MTVLCWRSHLLLLLLCLQLCVFGPSGSHAGKLLLFPMDGSHWLSMLGVIQQLQQKGHEVV
VIAPEASVYIKEGPFYTLKKYPVPFQVENVTASFAELGHSAFDQDPFLRRVVKTYERVKR
QSAMLLSGCSYLLHNAEFMASLEESHFDALLTDPFLPCGSIVAQFLALPSVYFLNTLPCG
LDLEATQCPAPLSYVPIGLTLNSDRMNFLERVRNMLFALSQNFLCNVVYSPYASLASEIL
QKEVTIKDLLSPASIWLMRYDFVKDYPKPIMPNMVIIGGINCLQKKPVSQEFEAYINASG
EHGIVVFSLGSMVSEIPQKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQN
DLLAHPKARAFITHSGSHGVYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVMLNVLEM
TADDLENALKTVINDKSYKENIMRLSSLHKDRPIEPLDLAVFWVEFVMRHKGAPHLRPAA
HDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAFGFRKCFGGKGRVKKSHKSKTH
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgactgtgctgtgctggagatcacatttgcttctgctcttgctgtgccttcagctgtgt
gtgttcggtccctcagggtcccacgctgggaagctgctgctgttccctatggatggcagc
cactggctgagcatgcttggagttattcagcagctccagcagaaggggcatgaggtagtg
gtcatagcgcctgaagcctcagtgtacataaaagaaggaccgttttacactttaaagaag
taccctgtgccatttcaagttgaaaacgtgacagcttcttttgcagaacttgggcacagt
gcctttgatcaggatccttttctgcggcgtgtggtcaaaacatacgagagagtcaaaagg
caatctgctatgctcctgtccggctgctcctacctgctgcacaatgccgagttcatggcc
tctctggaagaaagccactttgatgctctactgacagaccctttccttccttgtggctcc
attgtggcccagttcctggctctgccttctgtatacttcttgaatacattgccatgtggc
ctggatttggaagcgacccaatgccccgctcctctgtcctatgtgcccataggtctgact
ttaaactcagatcgcatgaatttcctggagcgagtgaggaacatgctctttgctttgtca
cagaactttctatgcaatgtggtttattctccctatgcatcacttgcctcggaaatctta
cagaaagaggtgactatcaaggaccttctgagccctgcatctatctggctgatgagatat
gactttgtgaaagattaccccaagccgatcatgcctaacatggttattattggtgggata
aactgtcttcagaaaaagcctgtatcccaggagttcgaagcctacatcaatgcctctgga
gagcatggcattgtggttttctccttgggatccatggtctctgaaattccacagaagaaa
gccatggaaatcgctgaggctttaggcaggattccccagacggtcctatggcgctacact
ggaactagaccatcgaatcttgcaaagaacacaatacttgtcaaatggctaccccaaaat
gatctgcttgctcatccaaaggctcgtgcattcatcacccactctggttcccatggagtt
tatgaaggaatatgcaatggcgtgccaatggtgatgatgcccttgtttggtgatcagatg
gacaacgccaagcgcatggaaactcgaggagctggggtgatgctgaatgtccttgaaatg
actgctgatgatttggaaaatgccctaaaaaccgtcatcaatgacaagagctacaaggag
aacatcatgcgcctctccagccttcacaaggaccgccctatagagcccctggacctggct
gtgttctgggtggagtttgtgatgaggcacaagggggcgccacaccttcgtccagctgcc
catgacctcacctggtaccagtaccactccttggatgtgattggcttcctcctggccatt
gtgttgacagtggtcttcattgtctttaaatgttgtgcctttggctttcggaaatgcttt
gggggaaaggggcgagttaagaaatcacacaaatccaagacccactga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110541412
Entry
110541412         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110541412
   00053 Ascorbate and aldarate metabolism
    110541412
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110541412
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110541412
   00860 Porphyrin and chlorophyll metabolism
    110541412
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110541412
   00982 Drug metabolism - cytochrome P450
    110541412
   00983 Drug metabolism - other enzymes
    110541412
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110541412
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110541412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110541412
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110541412
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110541412
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 110541412
NCBI-ProteinID: XP_021483841
LinkDB
Position
Unknown
AA seq 240 aa
MLKNVFLWSLQISLLGITLGGNVLIWPMEGSHWLNIKIIIDELIRKEHNVTVLVASGALF
ITPSISPSLTFDIYPVPFSKEKIESVIKDFVLTWLENRPSPSTIWKFYNEMAKVIKEFHV
VCRGICDGVLKNEKLMAKLKKGKFEVLLSDPVFPCGDIIAIKLGIPFIYSLRFSPASTVE
KHCGKVPFPPSYVPAILSELTDKMSFPDRVRNFISYRMQDYMFETLWKQWDSYYSKALGM
NT seq 723 nt   +upstreamnt  +downstreamnt
atgttgaaaaacgttttcctgtggtctcttcagataagtctcctgggaattactcttggc
gggaatgttctcatctggccaatggaaggcagtcactggctaaatattaagataataata
gatgagctcataaggaaagaacataatgtgactgtccttgttgcatccggtgcgcttttc
atcacaccatcaattagcccatctctgacttttgatatatatccagtgcccttcagcaag
gaaaaaattgaaagtgtgattaaggactttgtcttgacatggctggaaaacaggccgtct
ccttcaactatctggaagttctataatgaaatggccaaagtcattaaggagttccatgtg
gtgtgcagaggtatttgtgatggcgttcttaaaaatgaaaagctgatggccaaactgaag
aaaggaaagtttgaagtactgttatcagacccagtatttccatgtggtgatatcatagct
ataaaactgggaatcccatttatctattccttgaggttttctccagcctctaccgtggaa
aagcactgtggaaaggtcccattccctccttcctatgttcctgcaattttgtcagaactc
acagacaagatgtccttccctgacagagtcagaaacttcatctcctaccgaatgcaggac
tacatgtttgaaacgctttggaagcaatgggattcctattacagtaaagctttaggtatg
tag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110541609
Entry
110541609         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-8-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110541609
   00053 Ascorbate and aldarate metabolism
    110541609
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110541609
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110541609
   00860 Porphyrin and chlorophyll metabolism
    110541609
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110541609
   00982 Drug metabolism - cytochrome P450
    110541609
   00983 Drug metabolism - other enzymes
    110541609
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110541609
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110541609
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110541609
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110541609
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110541609
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 110541609
NCBI-ProteinID: XP_021484006
LinkDB
Position
Unknown
AA seq 294 aa
MAPAKCLASLPLCVCLLLASGFAQAGRLLVMPMDGSHWFTMKMVVEKLINRGHEVVAVIP
EVSWQLGQSLNFTVKTYSTSYTLEDLNHKFKVFSDAQWKNTEESMHTIVSGPAKDFMELL
FSHCRSLFKDKKLVEYLKQSAFDAVFLDPFYACGLIVAKYFSLPSVILARDIFCHYLEEG
AQCPGPLSYVPRRFSQFKDTMTFKERMWNHLFYLEELVFCPYFFKTVTDIASEVLQTPVT
MRDLFSPVSIWLLRTDFVLEFPRSVMPNMVFIGGLNCQQGKPLSKVEAAMIMAE
NT seq 885 nt   +upstreamnt  +downstreamnt
atggcccctgcaaagtgtctagcctcccttcctctgtgtgtgtgtctgctgttggcctct
ggctttgcccaggcaggcaggctcttggtcatgcccatggacgggagccactggttcact
atgaagatggttgtggagaaactcatcaacagagggcatgaggtggtggctgtcatacca
gaggtgagctggcaactgggacaatctctgaattttacagtgaagacatactcaacttct
tacactctggaggatctcaaccacaaattcaaggttttttctgacgctcagtggaaaaat
acagaagaaagtatgcatactatagtatcaggcccagctaaagatttcatggaattgtta
ttttcacactgtaggagtttgtttaaagacaagaagttagtggagtacttgaagcagagt
gcttttgatgctgtgtttctggatcctttttatgcttgtggcttaattgttgccaaatat
ttttctctcccatcagtgatcttagcaagagacatattttgccactatcttgaagagggt
gcccagtgccctggtcccctctcttatgttcctagacgtttctcacaatttaaagacacc
atgactttcaaggagagaatgtggaaccacctcttttaccttgaagaacttgtattttgt
ccctatttctttaaaactgttacagacattgcctctgaagttctccagaccccagtgact
atgagagaccttttcagcccagtatccatttggttgttacgcactgactttgtgcttgag
ttccccagatctgtgatgcccaacatggtcttcattggtgggctcaactgccagcaggga
aagccactttctaaggtggaagcagccatgataatggctgaataa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110542442
Entry
110542442         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B17-like isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110542442
   00053 Ascorbate and aldarate metabolism
    110542442
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110542442
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110542442
   00860 Porphyrin and chlorophyll metabolism
    110542442
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110542442
   00982 Drug metabolism - cytochrome P450
    110542442
   00983 Drug metabolism - other enzymes
    110542442
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110542442
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110542442
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110542442
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110542442
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110542442
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 110542442
NCBI-ProteinID: XP_021484707
LinkDB
Position
Unknown
AA seq 343 aa
MPVKWIFALLLLQMSCCFRSGNCGKVLVWPMEYSHWMNLKIILDELVQRGHEVTVLRPSA
SILLDPEKSPGLKFETFSTTISKDDLESFFTKIVNMWTYELPRDTCLSFSPLLQNIFTEY
SAYYQSLCKDTVSNKQLMAKLQKSKFDVLISDAIAPCGELIAELLHLPFLYSLRFTPGYT
MEKYTGGFVLPPSYVPMILSGLGGQMTFLERVKNMICMLYFDFWFQTFDEKKWDQFYSET
LGRPTTLAETVSKAEMWLIRSYWDLEFPHPTLPNVDYVGGLHCKPAKPLPEEMEDFVQSS
GEHGVVLFSLGSMVSNMTEEMANTVAWALAQIPQKDTPKPKPF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgcctgtgaagtggatttttgccctgctcctgctgcagatgagttgctgcttcagatct
ggtaactgtgggaaggtgttggtgtggccgatggagtacagtcactggatgaatttaaag
ataatactggatgaacttgtacagaggggtcatgaagtgactgttctgagaccatcagct
tccattttgcttgatcccgaaaaatcgcctggccttaaatttgaaactttttctacaact
atcagtaaagatgatctggaaagttttttcacaaagattgtgaatatgtggacttatgag
ctaccaagagatacatgtttatcattttctcccttgctacaaaatatttttacagaatat
tctgcttattatcaaagtctttgtaaagacacagtttcaaacaaacagcttatggcaaaa
ctgcagaaatccaagtttgatgtcctgatctcagatgcgattgctccctgtggggaactg
atagctgaactgctccatcttccttttctttacagtcttcgtttcactccaggctacaca
atggaaaagtacactggaggatttgtgctccctccctcttatgtacctatgattttgtca
gggctaggtggtcaaatgacattcttagagagggtgaaaaatatgatatgtatgctttat
tttgacttttggttccagacatttgatgaaaagaaatgggatcagttctacagtgaaact
ttgggaaggcccaccaccttagctgagacagtcagcaaagcagaaatgtggctcattagg
tcctactgggatttggaatttcctcacccaaccttaccaaatgttgactatgttggagga
ctccactgcaaacctgctaaacccttgcctgaggaaatggaagactttgtccagagctct
ggagagcatggggttgtgctgttttctttggggtccatggtcagtaacatgacagaggaa
atggccaacacagttgcatgggcccttgcccagattccacaaaaggacaccccaaaacca
aagcctttctaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110542799
Entry
110542799         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110542799
   00053 Ascorbate and aldarate metabolism
    110542799
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110542799
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110542799
   00860 Porphyrin and chlorophyll metabolism
    110542799
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110542799
   00982 Drug metabolism - cytochrome P450
    110542799
   00983 Drug metabolism - other enzymes
    110542799
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110542799
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110542799
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110542799
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110542799
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110542799
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_2 Glyco_transf_4
Other DBs
NCBI-GeneID: 110542799
NCBI-ProteinID: XP_021484975
LinkDB
Position
Unknown
AA seq 350 aa
LLLQLSVFFESGNSGKVLVWPMEFSHWLNLKTILDELVKKGHEVTVLIPSVSLSYKAENT
SAIEFETFPPSYPMADLEKLFLESINKCLYELPKQSFWGYFSMLLEIMLAESEYSESLCK
DVVFNKELMTKLQKSSFDVVLADPFIHCGDLLAEILKTPLVYSLRFFPGSTYEKYSGGLP
LPPSYVPVALSELTDRMTFMERVKNIIYVLYFDFWFQTFHKKRWDQLYSEVLGNRRIRRV
FWRTRCRGVFSGVHGGKPNRRKGQCDGSRPRPDSTEGHPKTRAFITHGGTNGIYEAIYHG
IPVIGIPLFGDQYDNIVHMKAKGAAVRLDFLTMSSTDLLNALKTVTNDPS
NT seq 1049 nt   +upstreamnt  +downstreamnt
ctcctgctacagctgagtgtcttctttgaatctggcaacagtgggaaggtgctggtgtgg
ccaatggaattcagccactggctcaacttaaagacaatcctggatgagcttgtgaaaaag
ggtcatgaagtgactgttctgataccttcagtttccctttcttacaaggctgaaaacaca
tctgctattgagtttgagacttttcctccgtcatatcccatggctgatttagagaaactt
tttctggaatccattaataagtgcctttacgagctgccaaagcaatcattttggggatac
ttttcaatgctgcttgaaattatgttggctgagtcagaatattctgaaagtctctgcaaa
gatgtagtttttaacaaggaactcatgacaaaactacagaaatcaagctttgatgtcgtc
ctagcagatccgttcatacactgtggagacttgctggctgagattctcaagacaccccta
gtatacagtctccgcttctttcctggctccacatatgaaaagtacagtggaggactccca
ttgcctccatcctatgtgcctgttgctctgtcagaattgaccgatagaatgacattcatg
gagagggtgaaaaatataatctacgtcctttattttgacttttggttccaaacatttcat
aagaagaggtgggatcagctttacagtgaagtattaggaaatagaagaattcgtcgagtc
ttctggagaacacggtgtcgtggtgttttctctggggtccatggtggcaaacctaacaga
agaaagggccaatgtgatggcagcaggcctcgcccagattccacagaaggtcatccaaaa
accagagctttcataactcatggtggcaccaatggcatctatgaggcgatctaccatggc
atccctgtgattggcatacctttgtttggagatcaatatgataatattgttcatatgaag
gccaaaggagcagctgttagactggactttctcacaatgtccagtactgatttgctcaat
gcattgaagacagtcactaatgacccttc

KEGG   Meriones unguiculatus (Mongolian gerbil): 110542840
Entry
110542840         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110542840
   00053 Ascorbate and aldarate metabolism
    110542840
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110542840
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110542840
   00860 Porphyrin and chlorophyll metabolism
    110542840
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110542840
   00982 Drug metabolism - cytochrome P450
    110542840
   00983 Drug metabolism - other enzymes
    110542840
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110542840
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110542840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110542840
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110542840
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110542840
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 110542840
NCBI-ProteinID: XP_021485004
LinkDB
Position
Unknown
AA seq 370 aa
MLKNVFLWSLQISLLGISLGGNVLILSPEVSHWLNIKIIIDELIRKEHNVTVLVTSSALF
ITPSTSPSLTFEIYPVPFSKEKMESVIKDLVLTWLENRPSPSTIWKFYNEMAKIFKELHM
MYKDTCDGVLKNEKLMAKLKKGKFEVLLSDPAFLCGDIIAIKLGIPFIYSLRFSPASTLE
KHCGKVPFPPSYVPAILSELTDKMSFPDRVRNFISYQMQDYMFEMIWKSWDSYYSKALGK
PTTFCEIMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQSSGEH
GVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYRGKIPATLGSNTRLFEWIPQNDL
LGKTLVEKSV
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgttgaaaaacgttttcctgtggtctcttcagataagtctcctgggaattagtcttggt
gggaatgttctcatcttgtcaccagaagtcagtcactggctaaatattaagataataata
gatgagctcataaggaaagaacataatgtgactgtccttgttacatccagtgcgcttttc
atcacaccatcaactagcccatctctgacttttgaaatatatccagtgcccttcagcaag
gaaaaaatggaaagtgtgattaaggacttggttttgacatggctggaaaacaggccatct
ccttcaactatctggaagttctataatgaaatggccaaaatctttaaggagctccatatg
atgtacaaagatacttgtgatggcgttcttaaaaatgaaaagctgatggccaaactgaag
aaaggaaagtttgaagtactgttatcagacccagcatttctatgtggtgatatcatagct
ataaaactgggaatcccatttatctattccttgaggttttctccagcctctactttggaa
aagcactgtggaaaggtcccattccctccttcctatgttcctgcaattttgtcagaactc
acagacaagatgtccttccctgacagagtcagaaacttcatctcctaccaaatgcaggac
tacatgtttgaaatgatttggaagtcatgggattcctattacagtaaagctttaggaaaa
cccaccactttttgtgagattatggggaaagctgagatttggctgatacggacatactgg
gactttgaattccctcgtccatatttacctaattttgagtttgtgggaggactgcattgc
aaacctgccaaacctttacctaaggaaatggaagaatttgtccagagctcaggggaacat
ggtgttgtggtgttttctctggggtcaatggtcaaaaatttgacagaagaaaaggccaac
ctcattgcctcagcccttgcccagattccccagaaggttttgtggcgatacagaggaaag
ataccagccactttaggatccaatacaaggctgtttgagtggattccccagaacgatctt
cttggtaagactctggtagaaaaatctgtgtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110542873
Entry
110542873         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A3-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110542873
   00053 Ascorbate and aldarate metabolism
    110542873
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110542873
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110542873
   00860 Porphyrin and chlorophyll metabolism
    110542873
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110542873
   00982 Drug metabolism - cytochrome P450
    110542873
   00983 Drug metabolism - other enzymes
    110542873
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110542873
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110542873
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110542873
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110542873
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110542873
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C S1FA
Other DBs
NCBI-GeneID: 110542873
NCBI-ProteinID: XP_021485037
LinkDB
Position
Unknown
AA seq 534 aa
MVPEKWAAVVFLLHLCCAGCGFCGKVLVWPCDMSHWLNLKTILEALAARGHEVTVLKYSA
ILIDQNQHSALHFENIPLRYENEIAEHYLKEMVNLAVNVIPNLSLWQAARTLQDFFLQLT
EVFEDLCRSVLYNQTFMSKLRDAKYDVMVIDPVVPCGELTADVLQIPFVNTLRFSMGYSM
EKYCGQLPVPLSYVPVVMGELTDSMTFTERVKNMILSLFFEFWIQQYDFSFWDQFYSEAL
GRPTTFCKTVGKAEIWLIRTYWDFEFPRPYLPNFDFVGGLHCKPAKPLPKEIEEFVQSSG
EHGVVVFSLGSMVKNLTEEKANLIASALSQIPQKVLWRYSGKKPTTLGSNTRLFNWIPQN
DLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPMFADQPDNIAHMKAKGAALKMNINTM
TSSDLLSALRAIINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEYVMRHKGAKHLRVAA
HDLSWVQYHSLDVIGFLLACVVTLTFIITKCCLFTYQKCCVTEKKKKVNRKKEN
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggtgcctgagaagtgggctgcagtagtttttctgctgcacctgtgctgtgctggctgt
ggcttctgcggcaaggtccttgtgtggccctgtgatatgagccactggctgaacctaaag
actattcttgaggcgctggcagcaagagggcatgaagtgacagtcctgaaatattctgct
atccttatagatcagaatcaacattctgcactgcactttgagaatatccctttgcgttat
gaaaatgagatcgctgagcattatctaaaagagatggtaaatctagctgtgaatgtcatt
ccaaacttgtccttgtggcaagcagcaagaacactgcaggatttctttcttcagctgact
gaagtttttgaagatctttgcaggagtgtgttgtacaaccagacattcatgagcaagctc
cgggatgcaaaatatgatgtgatggttatagaccctgtcgttccctgtggagagctcacg
gcagacgtgcttcagattccttttgtaaacacgctgaggttcagcatgggctacagcatg
gaaaaatactgtggccagcttccagttccactttcttatgtaccggtcgtcatgggtgaa
ctaacagacagtatgacctttacagaaagggtgaaaaatatgatactttcactgtttttt
gaattttggatccagcagtatgacttttcattctgggatcagttttacagtgaagcacta
ggaagacccaccacgttctgtaagactgtgggtaaagctgaaatttggctcatccgaaca
tattgggattttgaatttcctcgtccatatttgccaaattttgattttgtgggaggactg
cactgcaaacctgccaagccattacctaaggaaatagaagaatttgtccagagctcaggg
gaacacggtgttgtggtgttttctctggggtcaatggtcaaaaaccttacagaagagaag
gccaacctcattgcctcagccctttcccagattcctcagaaggttttgtggagatactca
ggcaagaaaccaaccactttaggatccaatactcggctttttaattggattcctcagaac
gatcttcttggacatcctaaaaccaaagctttcatcactcatggtggaacaaatgggatc
tatgaagccatttaccatgggatccctatggtgggaattcccatgttcgctgatcagcct
gacaacattgctcacatgaaggccaagggagcagccttgaaaatgaacatcaacacaatg
acaagctcagatttactcagtgccttgagagccatcattaatgagccttcttataaagag
aatgccatgagattatcaagaatccaccatgatcagccagtgaagcccctggacagagct
gtcttctggattgagtatgtcatgcgccacaaaggagccaagcaccttcgtgtggcagca
catgacctcagctgggtccagtatcactctctggatgtgattggattcttgctggcctgt
gttgtaactctgacattcatcatcactaaatgttgtttgtttacttatcaaaaatgttgt
gtgacagaaaagaagaaaaaggtgaacagaaaaaaagaaaactag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543332
Entry
110543332         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110543332
   00053 Ascorbate and aldarate metabolism
    110543332
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110543332
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110543332
   00860 Porphyrin and chlorophyll metabolism
    110543332
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110543332
   00982 Drug metabolism - cytochrome P450
    110543332
   00983 Drug metabolism - other enzymes
    110543332
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110543332
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110543332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110543332
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110543332
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110543332
SSDB
Motif
Pfam: UDPGT Glyco_transf_4 Glyco_trans_4_2 Glyco_trans_4_4
Other DBs
NCBI-GeneID: 110543332
NCBI-ProteinID: XP_021485364
LinkDB
Position
Unknown
AA seq 301 aa
MKYQKTPFQHDAHETTSVFQLLQLICFLRTGTCGKVLVWPTEYSHWINIKMILDELVQKG
HEVTVLTSSASFLIQPSNETSINFEIYSVPLSKGDLEYLLGKWIGEWTNDFYNYPFWTYF
SKMQKIFIEYSDVIENFCKAVVWNKSLMKKLRESKFDVILADAIGPCGELLAELLKKPLV
YTLRFCPGYKCEKYSGGLPLPPSYVPAVLSELSDRMTFLERVKNMLHMLYFDFWFQAFNE
NSWSQFYSEALGRPTTLGEMMGKADIWLIRTYWDLEFPHPLLPNFVFVGGLYCKPAKPLP
E
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaaatatcaaaagactccatttcagcatgatgcccatgaaacaacttcagtttttcag
ttattacaactgatatgcttcttaagaactggaacttgtggaaaagtgctggtatggccc
acagaatacagccattggatcaatataaagatgattctcgatgagcttgtccagaaaggt
catgaagtgactgttctgacatcttcagcttcattccttattcagcctagcaatgaaact
tctattaattttgaaatttactctgtacctttgagtaaaggagatcttgaatatctgctt
ggaaaatggataggtgaatggacaaatgatttttacaattacccattttggacatatttt
tctaaaatgcaaaaaatctttattgaatattctgatgtgattgaaaatttctgcaaagct
gtagtttggaacaagagtcttatgaaaaagctacgagaatctaagtttgatgtcattctc
gcagatgccataggtccctgtggtgagctgctagccgaactgcttaagaaacctttagtg
tacactcttcgcttctgtcctggatacaagtgtgaaaagtacagcgggggacttccactc
cctccttcctatgtgcctgcggttttatcagaattaagtgaccgaatgacatttctggaa
agggtgaagaatatgttgcatatgctgtattttgacttttggtttcaagcatttaatgag
aattcgtggagtcagttttacagtgaggctctagggagacccacaacgttaggtgagatg
atggggaaagcagacatttggctcattcgaacttactgggacttggaatttcctcaccca
ctcttacctaattttgtctttgtgggaggactctactgcaaaccagccaaaccactgcct
gag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543424
Entry
110543424         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B17-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110543424
   00053 Ascorbate and aldarate metabolism
    110543424
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110543424
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110543424
   00860 Porphyrin and chlorophyll metabolism
    110543424
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110543424
   00982 Drug metabolism - cytochrome P450
    110543424
   00983 Drug metabolism - other enzymes
    110543424
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110543424
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110543424
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110543424
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110543424
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110543424
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 110543424
NCBI-ProteinID: XP_021485439
LinkDB
Position
Unknown
AA seq 337 aa
MPVKWIFALXFLLQMSCCFRSGNCGKVLVWPMEYSHWMNLKIILDELVQRGHEVIVLRPS
ASIFLDPEKSPGLKFETFSTTISKDDLESFYAKIVNMWTYEMPTELCLHSPLLQNMFTEY
SAYYQSLCKDTVSNKQLMAKLQKSKFDVLISDAIAPCGELIAEMLHLPFLYSLRCTPGYT
MEKYNGGFVLPPSYVPMILSRLGGQMTFLERVKNMICMLYFDFWFQTFDEKKWDQFYSET
LGRPTTFAEMVSKAEMWLIRSYWDLEFPHPTLPNVDYVGGLHCKPAKPLPEEMEDFVQSS
GEHGIVLLSLGSMVSNMTEETANTIAWALAQIPQKVR
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcctgtgaagtggatttttgccctgntgttcctgctgcagatgagttgctgctttaga
tctggtaactgtgggaaggtgttggtgtggccgatggagtacagtcactggatgaattta
aagataatactggatgaacttgtacagaggggtcatgaagtgattgttctgagaccatca
gcttccatttttcttgatcccgaaaaatcgcctggccttaagtttgaaactttttctaca
actatcagtaaagatgatctggaaagtttttatgcaaagattgtgaatatgtggacttat
gagatgccaacagaactatgtttacattctcctttgctacaaaatatgtttacagaatat
tctgcttattatcaaagtctttgtaaagacacagtttcaaacaaacagcttatggcaaaa
ctgcagaaatccaagtttgatgtcctgatctcagatgcgattgctccctgtggggaactg
atagctgaaatgctccatcttccttttctgtacagtcttcgttgcactcctggctacaca
atggaaaagtacaatggaggatttgtcctccctccctcttatgtacctatgattttgtca
agactaggtggtcaaatgacattcttagagagggtgaaaaatatgatatgtatgctttat
tttgacttttggttccagacatttgatgagaagaaatgggatcagttctacagtgaaact
ttgggaaggcccaccacctttgcagagatggtaagcaaagcagaaatgtggctcattaga
tcctactgggatttggaatttcctcacccaactttaccaaatgttgactatgttggagga
ctccactgcaaacctgctaaacccttgcctgaggaaatggaagactttgtccagagctct
ggagaacatgggattgtgctgctttctttggggtccatggtcagtaacatgacagaggaa
acggccaacacaattgcatgggcccttgcccagattccacaaaaggtgagataa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543704
Entry
110543704         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110543704
   00053 Ascorbate and aldarate metabolism
    110543704
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110543704
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110543704
   00860 Porphyrin and chlorophyll metabolism
    110543704
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110543704
   00982 Drug metabolism - cytochrome P450
    110543704
   00983 Drug metabolism - other enzymes
    110543704
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110543704
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110543704
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110543704
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110543704
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110543704
SSDB
Motif
Pfam: UDPGT Glyco_transf_4 Glyco_trans_4_2
Other DBs
NCBI-GeneID: 110543704
NCBI-ProteinID: XP_021485626
LinkDB
Position
Unknown
AA seq 291 aa
MPAKQTLVFLLLQLICFLRTGTCGKVLVWPTEYSHWINIKMILDELVKRGHEVTVLTSSA
SVLIEPSNETSINFEIYSVPLSKEDLDNVFGKWIGDPTNKFQDYPFWTYFSKMQKVPSEY
SDVIENFCKAVVWNKRLMKKLRESKFDVILADAIGPCGELQAELLKKPLVYSLRFCPGYK
CEKYSGGLPLPPSYVPVVFSELSDRMTFLERVKNMLQLLYFDFWFQTFNEKSWSRFYSEA
LGRPTTLGEMMGKADIWLIRTYWDLEFPHPLLPNFDFVGGLHCKPAKPLPE
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcccgcaaaacagactttagtttttctgttattacagctgatatgcttcttaagaact
ggaacttgtggaaaagtgctggtatggcccacagaatacagccattggatcaatataaag
atgattctcgatgaacttgtgaagagaggtcatgaagtgactgttctgacatcttcagct
tccgtccttattgagcctagtaatgaaacttctattaattttgaaatttactctgtacca
ttgagtaaagaagatcttgacaatgtgtttggaaaatggataggtgatccaacaaacaaa
tttcaagattacccattttggacatatttttctaaaatgcaaaaagtccctagtgaatat
tctgatgttattgaaaatttctgcaaagctgtagtttggaacaagcgtcttatgaaaaag
ctccgagaatctaagtttgatgtcattctcgcagatgccataggtccctgtggtgagctg
caggccgaactgcttaagaaacctttagtgtactctcttcgcttctgtcctggatacaag
tgtgaaaagtacagtgggggacttccactccctccttcctatgtgcctgtggttttctca
gaattaagtgaccgaatgacatttctggaaagggtgaagaatatgttgcaactactgtat
tttgacttttggtttcaaacatttaatgagaagtcgtggagtcggttttacagtgaagct
ctagggagacccacaacgttaggtgagatgatggggaaagcagacatttggctcattcga
acttactgggacttggaatttcctcacccactcttacctaattttgattttgtgggagga
ctccactgcaaaccagccaaaccactgcctgag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110544093
Entry
110544093         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A2-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110544093
   00053 Ascorbate and aldarate metabolism
    110544093
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110544093
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110544093
   00860 Porphyrin and chlorophyll metabolism
    110544093
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110544093
   00982 Drug metabolism - cytochrome P450
    110544093
   00983 Drug metabolism - other enzymes
    110544093
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110544093
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110544093
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110544093
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110544093
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110544093
SSDB
Motif
Pfam: UDPGT Glyco_trans_4_2 Glyco_transf_4 Glyco_trans_4_4
Other DBs
NCBI-GeneID: 110544093
NCBI-ProteinID: XP_021485888
LinkDB
Position
Unknown
AA seq 252 aa
MFKKFLQLFVFHLALTEIVLSGNVLIWPTDCSHWLNIKILLEELSQRNHSVTVLTSSTTL
FINSTPDAFLHFEEIPVSYKKSNIEEIIEHMISLWLNHRPTPLTMWTFYKELGKLFEAFY
KINTQVCDGVLNNPTLMAKLQKASFDVLIADPVTICGDLVALKLGIPFVYTMRFSPAFTV
ERHCGKIPSPFSYVPAALSELSDQMSFGERVKNTLSYSLQDFIFKSYWGGWNSYYSRVLG
ESQGFSPVDDPR
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtttaagaagtttttacagctgtttgtttttcatttggctctgactgaaattgttctc
agcgggaatgtgctaatttggcctacagactgcagccattggttaaatattaagattctt
cttgaagagctgagtcaaagaaatcacagtgtgactgtactgacttcatcaacaacttta
ttcatcaactccactcctgatgccttcttgcattttgaagagattccggtttcctacaaa
aaaagcaacatagaggaaataattgagcatatgatctcactgtggctaaaccacagaccg
acacctctcacaatgtggactttctacaaagaactgggaaagctctttgaggccttctac
aaaattaatacacaagtctgtgatggtgtgttaaacaatcccacgctaatggcaaaactt
caaaaggctagcttcgatgtgttgatagctgatccagtaaccatctgtggagacctggtg
gccctgaaattgggaattccgtttgtgtacacaatgcgattctctccagcctttacagtg
gagaggcactgtgggaaaattccttcaccattctcttacgtacctgcagccttgtcagag
ctcagtgaccagatgtcctttggtgaaagggttaagaacaccctatcttattctctacaa
gactttatatttaagtcctactggggaggatggaattcctactacagcagagttctgggt
gagtctcagggtttttcccctgttgatgaccccagataa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110554542
Entry
110554542         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-6-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110554542
   00053 Ascorbate and aldarate metabolism
    110554542
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110554542
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110554542
   00860 Porphyrin and chlorophyll metabolism
    110554542
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110554542
   00982 Drug metabolism - cytochrome P450
    110554542
   00983 Drug metabolism - other enzymes
    110554542
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110554542
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110554542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110554542
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110554542
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110554542
SSDB
Motif
Pfam: UDPGT Glyco_transf_4
Other DBs
NCBI-GeneID: 110554542
NCBI-ProteinID: XP_021502884
LinkDB
Position
Unknown
AA seq 325 aa
MACLLRAGQRVPLGLLFLILWGSVLGDKLLVFPQDGSHWLSMKEIVEHLSQRGHDIVVLV
PEVNLLLGESKYYTRKTFPVPYDLEELKRRYRAFGNQHFTPGSQLLAPLKEYRNNMIVID
MCFFSCQNLLKDSATLTFLRESKFDALFTDPAIPCGVILAEYLKLPSAYLFRGFPCYLEH
MHGQSPSPVSYIPRFYTKFSDHMTFPQRVANFIVNVMENYLFYCLYSKYEVLASDLLKRY
VSLPALHQNSVWLLRYDFVFEYPRPVMPNMIFIGGLNCKKEAKLSQVGGLMSSGCIISSL
ADLVLVSCSFSYVWHQLPLLRKMVS
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcttgccttcttcgtgccggtcagagggttccactagggcttctcttcttaatactc
tggggctcagttctaggtgacaagctgctggtgttcccccaggatggaagccactggctt
agcatgaaggagatagtggagcacctcagtcaaagggggcatgatattgtggtgctagtg
ccggaggtcaatttgcttttgggagaatccaaatactacacaaggaaaaccttcccagtg
ccgtatgacctggaggagctgaagcgccgttaccgtgcctttggaaaccagcactttact
cccggttcacagcttttggctcctctaaaagagtacaggaacaacatgattgtcatcgac
atgtgctttttcagctgccagaacctcctgaaggactctgccaccctcaccttcctcagg
gagagcaagtttgatgctctgttcacagacccggccattccctgtggtgtgatcctggct
gagtacctcaagctgccctccgcttaccttttcagaggctttccatgctatctggagcat
atgcacggtcaaagtccaagccccgtgtcctacattcccagattctataccaaattctca
gaccacatgacatttccccaacgggtggccaacttcattgttaatgtcatggagaactac
ttattttattgtctgtattcaaagtatgaagtccttgcctcagacctcctcaagagatat
gtgtccctacctgccttacaccagaactctgtgtggctgttacggtatgactttgtgttc
gaatacccacggccagtcatgcccaacatgatcttcattggagggcttaactgcaagaag
gaggcaaaactgtctcaggtgggtggactcatgtcttctggctgcattatctcttccttg
gcagatctggttcttgtcagctgctccttctcctatgtttggcatcagctacctctcctt
aggaagatggtcagttga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110554545
Entry
110554545         CDS       T05884                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-8-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00140  Steroid hormone biosynthesis
mun00830  Retinol metabolism
mun00860  Porphyrin and chlorophyll metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
mun04976  Bile secretion
mun05204  Chemical carcinogenesis
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110554545
   00053 Ascorbate and aldarate metabolism
    110554545
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110554545
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110554545
   00860 Porphyrin and chlorophyll metabolism
    110554545
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110554545
   00982 Drug metabolism - cytochrome P450
    110554545
   00983 Drug metabolism - other enzymes
    110554545
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110554545
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110554545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110554545
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     110554545
Glycosyltransferases [BR:mun01003]
 Others
  Hydrophobic molecule
   110554545
SSDB
Motif
Pfam: UDPGT Thymidylate_kin IP_trans
Other DBs
NCBI-GeneID: 110554545
NCBI-ProteinID: XP_021502886
LinkDB
Position
Unknown
AA seq 293 aa
MAPAKCPASLPLCVCLLLASGFAQAGRLLVVPMDGSHWFTMQMIVEKLSHRGHEVVVVKP
EVSWQLGKSLNFTVKIYSVSYTLEDLNHHFNFFAQTQWKTQEVGMFALLKNSGKGFFDLL
FSHCRSLFNDKELVEYLKQSAFDAVFLDPFDVCGLTVAKYFSLPSVVFSGGIFCHYLEDG
AQCPSPPSYVPRFLLKFTDTMTFKERVWNYLSHMKERAFCPYFFKTATDIASEVLQTPVT
MRDLFSSVSIWLFRTDFVLDFPRPVMPNMVYVGGLNCQQGKPLSKVCYIFFST
NT seq 882 nt   +upstreamnt  +downstreamnt
atggctcctgcgaagtgtccagcctcccttcctctgtgtgtgtgtctgctgttggcctct
ggctttgcccaggcaggcaggctgctggtggtgcccatggacgggagccactggttcacc
atgcagatgattgtggagaaactcagccacagagggcacgaggtggtagtagtcaaacca
gaggtgagctggcaactgggaaaatcactgaattttacagtgaaaatttactccgtttct
tacactctggaagatttgaaccaccacttcaatttttttgctcaaactcaatggaaaact
caagaagtaggaatgtttgctctactaaagaattcaggcaaaggtttctttgacttatta
ttttcacactgtaggagtttgtttaacgacaaggagttagtggagtacttgaagcagagt
gcttttgatgctgtgtttctggatcctttcgatgtgtgtggcttaactgttgccaagtac
ttttcactcccatctgtggtcttcagcggaggaatattttgtcactaccttgaagacggt
gcccagtgccccagtcccccgtcttatgttccaagatttctcttaaaattcacagacacc
atgactttcaaggagagagtgtggaactatctctcccacatgaaggagcgtgcattttgc
ccctatttcttcaaaactgctacagacattgcctctgaagttctccagaccccagtgact
atgagagacctcttcagctcagtgtccatttggttgtttcgcactgactttgtgctggac
tttcccagacctgtcatgcccaacatggtctacgttggtggactcaactgccagcagggg
aagccactttctaaggtatgttatatcttctttagcacatga

DBGET integrated database retrieval system