KEGG   Meriones unguiculatus (Mongolian gerbil): 110540621
Entry
110540621         CDS       T05884                                 

Gene name
Tab2
Definition
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 isoform X1
  KO
K04404  TAK1-binding protein 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04064  NF-kappa B signaling pathway
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04668  TNF signaling pathway
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05161  Hepatitis B
mun05162  Measles
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110540621 (Tab2)
   04064 NF-kappa B signaling pathway
    110540621 (Tab2)
   04668 TNF signaling pathway
    110540621 (Tab2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110540621 (Tab2)
   04621 NOD-like receptor signaling pathway
    110540621 (Tab2)
   04657 IL-17 signaling pathway
    110540621 (Tab2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110540621 (Tab2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110540621 (Tab2)
   05135 Yersinia infection
    110540621 (Tab2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110540621 (Tab2)
   05161 Hepatitis B
    110540621 (Tab2)
   05171 Coronavirus disease - COVID-19
    110540621 (Tab2)
   05162 Measles
    110540621 (Tab2)
   05168 Herpes simplex virus 1 infection
    110540621 (Tab2)
   05169 Epstein-Barr virus infection
    110540621 (Tab2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110540621 (Tab2)
   05140 Leishmaniasis
    110540621 (Tab2)
SSDB
Motif
Pfam: CUE zf-RanBP Spc29 DivIC
Other DBs
NCBI-GeneID: 110540621
NCBI-ProteinID: XP_021483040
LinkDB
Position
Unknown
AA seq 691 aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDESGISGLRNHMTSLNLDLQSQNVYHHGREGSRVNGSRTLTHSVSDGQLQGGQSNNE
LFQQEPQTAPAQVPHGFSVFGMPSTSGASNSTPHLGFHLGSKGPPNLSQQTPRFNPIMVT
LAPNIQTGRSTPTSLHIHGVPPPALNSPQGNSIYIRPYITTPSGTARQTQQHSGWVSQFN
PMNPQQAYQPSQPGPWTTYPASSPLPHTSAQQPTQQGHQTSHVYMPISSPTTPQPPAVHS
SGSAQSSAQYNIQNISTGPRKNQIEIKLEPPQRNSSSKLRASGPRTASTSSVVNSQTLNR
NQPTVYIAASPPSTDEMVSRSQPKVYISANATTGDEQGMRNQPTLFISTNSGPSATSRNM
SGQVSMGPAFIHHHPPKSRVLGGNSAASPRVVVTQPNTKYTFKITVSPNKPPAVSPGVVS
PTFELTNLLNHPDHYVETENMQHLTDPALAHVDRISEARKLSMGSDDAAYTQALLVHQKA
RMERLQRELEMQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNRQL
QIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQKPTTKAPKTHDTED
EEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacagaaattc
cccgaagtgcctgaagttgttgtgtccaggtgtatgttacagaacaataacaacctggat
gcctgctgtgctgttctctctcaggagagtacacggtatctttatggtgaaggagacctg
aacttttcagatgagtctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcagtcacagaatgtttaccaccacggaagagaaggaagcagagtaaatggaagt
cggactctgacacacagcgtcagtgatggacagcttcaaggtgggcagtccaacaatgaa
ctgttccagcaggagccacagacagcaccagctcaagttcctcacggcttcagtgtgttt
ggaatgcccagcacatctggtgcttcaaattcaacaccacatcttggatttcacctaggc
agcaaagggccacctaacctctctcagcaaactcccagatttaaccctattatggtgacg
ttagccccaaacatacagactggtcggagcactcctacgtctctgcacatacatggtgta
cctccgcccgcacttaacagcccacagggaaattctatctatatcaggccttatattaca
actcctagtggtacagctcggcagacacaacagcattctggctgggtatctcagtttaat
cccatgaaccctcagcaagcctatcaaccttcgcagcctggtccttggactacctaccct
gcgtccagtcctttgccacatacctcagcccaacagcccactcagcagggccaccagacc
tctcatgtctacatgcccatcagctcgccgactaccccacagccaccagcagtccactca
tcgggtagcgctcagtcttctgcccagtataacattcagaacatttcaacaggacctcga
aaaaaccagatagaaatcaaacttgaacccccacagagaaacagttcttcaaaattacgt
gcttctggacctcgaactgccagcacgtcttcagtggtcaacagccagaccttaaataga
aatcagcccactgtttacatagctgccagtcctccaagtactgatgagatggtctcccgt
agtcaacctaaggtctatatttcagccaatgccaccacaggagatgagcagggcatgcgg
aatcaacctacactcttcatatccacaaactctgggccatctgccacctccaggaacatg
tctgggcaagtgagcatgggtcctgcctttatccatcaccaccctcccaaaagccgagtg
ttgggggggaactctgcagcgtctcctcgagtggtggtcactcagcccaacacgaaatat
actttcaaaattacagtttctcccaataagcccccggcagtctccccaggggtagtctcc
cctacctttgagcttacgaaccttctgaatcaccctgaccattatgtagagacagagaat
atgcagcacctcacggaccctgctttagcacatgtggataggataagtgaagctcggaaa
ctgagtatgggatctgatgatgctgcctacacacaagctctgctggtgcaccagaaggcc
aggatggaacggcttcaaagagagctcgagatgcagaagaaaaagctggataaactcaaa
tctgaggtcaatgagatggaaaataatctaactcgaaggcgcctgaagagatcaaattcc
atatcccaaataccttcactcgaagaaatgcagcagctgagaagttgtaataggcaactc
cagattgacattgactgcttaaccaaagagattgatctttttcaagcccgaggaccacat
tttaaccccagcgctattcataacttttatgacaatattggatttgtaggtcctgtgcca
ccaaaacccaaagatcagaagcccaccaccaaagcaccaaagactcacgacacagaggat
gaggagggggctcagtggaattgcactgcctgtacttttttgaatcacccggccttgatc
cgctgtgaacagtgtgagatgcctcggcatttctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110557813
Entry
110557813         CDS       T05884                                 

Gene name
Tab1
Definition
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04064  NF-kappa B signaling pathway
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04668  TNF signaling pathway
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05161  Hepatitis B
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110557813 (Tab1)
   04064 NF-kappa B signaling pathway
    110557813 (Tab1)
   04668 TNF signaling pathway
    110557813 (Tab1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110557813 (Tab1)
   04621 NOD-like receptor signaling pathway
    110557813 (Tab1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110557813 (Tab1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110557813 (Tab1)
   05135 Yersinia infection
    110557813 (Tab1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110557813 (Tab1)
   05161 Hepatitis B
    110557813 (Tab1)
   05168 Herpes simplex virus 1 infection
    110557813 (Tab1)
   05169 Epstein-Barr virus infection
    110557813 (Tab1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110557813 (Tab1)
   05140 Leishmaniasis
    110557813 (Tab1)
SSDB
Motif
Pfam: PP2C
Other DBs
NCBI-GeneID: 110557813
NCBI-ProteinID: XP_021508093
LinkDB
Position
Unknown
AA seq 502 aa
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDNWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNTEHTEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKALERETSGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNMDHTTENEDELFRLSQLGLDTGKIKQVGVICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAKFCPRHEDMTL
LVRNFGYPLGEMSQPTPAPAPGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGSH
SASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYV
DFAEFYRLWSVDHGEQSVMTAP
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcctgctccagagtgagcagcagccgagctggacagatgac
ctgccactctgtcacctctctggagttggctcagcttccaaccgtagctactctgctgat
ggcaagggcactgagagccaccctccagaggataactggctcaagttcagaagtgaaaac
aactgcttcctgtatggggtcttcaatggctatgatggcaaccgggtgaccaactttgtg
gcacagaggctctctgcagagctcctgctgggccagctcaacacggaacacactgaggct
gatgtgcggcgggtcctgctgcaggccttcgatgtggtggagaggagcttcctggagtcc
attgatgatgccttagccgagaaagcaagcctccagtcccagctgccagagggtgtgccc
caacaccagctgccacctcagtatcagaagatccttgagagactcaaggcgctggagagg
gagacttcgggaggggccatggccgttgtggcagtccttctcaacaacaagctctacgtt
gccaatgtcggtacgaaccgggcccttctctgcaaatctacagtggatgggttacaggtc
acacagctaaacatggaccacaccactgaaaatgaggatgagctctttcgtctttcacag
ctgggtttggacacaggaaagatcaagcaggtgggcgtcatctgtggacaggagagcacc
aggcgcattggggattacaaggtcaaatatggctacactgacatagacctgctcagtgct
gccaagtccaaacccatcatcgcagagccggaaattcatggtgcgcagcctctggatggt
gtgacgggcttcctggtgctgatgtctgaggggctgtacaaggccctggaggcagcccat
gggcctgggcaagccaaccaggagattgcagcaatgattgacactgaatttgctaagcag
acctccctggatgcggtggcccaggctgtggttgaccgtgtaaagcgtatccacagtgac
acctttgccagcggtggggagcgtgccaagttctgcccacggcatgaagacatgaccctg
ctggtgaggaactttggctatccattgggtgaaatgagccagcctacaccggccccagcc
ccagggggtcgtgtgtatcctgtttctgtgccatactcaagtgcccagagcaccagcaag
accagtgtgactctgtccctcgtcatgccttctcagggccagatggtcaatggctctcac
agtgcctccaccctggatgaagccactcccaccctcactaaccagagccccactctgacc
ctgcagtccaccaacacacacacgcagagcagcagctccagctctgacgggggcctcttc
cgctccagacccgctcactcacttcctcctggagaggacggccgcgttgagccttatgtg
gactttgccgagttttaccgactctggagtgtggaccacggcgagcagagcgtgatgaca
gcaccttag

DBGET integrated database retrieval system