KEGG   Meriones unguiculatus (Mongolian gerbil): 110540843
Entry
110540843         CDS       T05884                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: speckle-type POZ protein B-like
  KO
K10523  speckle-type POZ protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110540843
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110540843
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110540843
SSDB
Motif
Pfam: BTB BACK
Other DBs
NCBI-GeneID: 110540843
NCBI-ProteinID: XP_021483307
LinkDB
Position
Unknown
AA seq 362 aa
NFKLPPAEVSDNLTAESWGSTEITIQIFSYRWIISNFSFYQEGMREAIESATFSSGANNK
LQSLLRVHPNGSDEDSKDELSVYLVLLHCSTSPIWAKFYFWIINAEGEKCQGQWSQIVFR
FLPGSNWGFKKFILREFLLSQEEHLLREDQLTLLCDVYVVQDSCSIPGKNTTTAIKVPSC
TLTDEVGELLENSLFTDCCFLVSGQEFWAHKAILAAQSPVFRDMFEHNMEKGQKNRVEIK
DLEPQVLKEMMGFIYTXLATAVLVVADRYGLERLKVMCEDALCRDLSVENATNTLILADL
HSAEQLKMQALDFITLHASDVSETSGWKVMVDFHPHLLAEEFHALASAQRLFLETPLKRL
KR
NT seq 1089 nt   +upstreamnt  +downstreamnt
aacttcaaactgcctccagcagaagtgtcagacaacctgacagctgagagctggggctcc
accgaaataaccatccagatattttcctacaggtggatcatcagcaatttctccttttac
caggagggaatgagggaagccattgaaagtgccacattctcatcaggagccaataacaaa
ctccaatcgcttttgagagtacaccccaatgggagcgatgaagatagcaaggatgaactg
tcagtttacctagtgttgctccactgttcaacaagccccatttgggccaagttctacttt
tggatcataaatgctgaaggagagaaatgccaaggacagtggagccaaattgtctttaga
ttcctgccaggcagcaactggggattcaaaaagttcatccttagagaatttctcttgtct
caggaagaacaccttctccgtgaggaccaattgaccctcttgtgtgatgtgtatgtggtt
caagactcctgcagcattccaggaaagaacacgacaacggcaatcaaggttccaagctgc
actttgacagatgaggtaggagagcttttggagaattccctcttcacagactgctgcttc
ttggtatctggtcaggaattctgggctcacaaggccatcttagcagctcaatctccagtt
ttcagagacatgtttgaacataacatggagaagggacaaaagaaccgagttgagatcaag
gacctggagcctcaagtcttgaaggagatgatgggcttcatttacacanccttggccact
gctgtgctggtagttgctgacaggtatggcctggagcgcttgaaggtcatgtgtgaggat
gccctgtgcagggacctctcagtggagaatgccactaacactctcatcctggctgacctc
cacagtgcagagcagctgaaaatgcaggcattggatttcattacacttcatgcttctgat
gtctctgaaacttcagggtggaaggtcatggtggatttccatccccacttgctggctgaa
gaattccatgccctggcttctgcacagaggctattcctggaaacccctctcaaacgcctg
aagagatag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110540845
Entry
110540845         CDS       T05884                                 

Definition
(RefSeq) speckle-type POZ protein-like
  KO
K10523  speckle-type POZ protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110540845
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110540845
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110540845
SSDB
Motif
Pfam: BTB BACK
Other DBs
NCBI-GeneID: 110540845
NCBI-ProteinID: XP_021483309
LinkDB
Position
Unknown
AA seq 359 aa
MTEDLAAESWGSTHITIKTFSYKWTISNFHFSLEGLSEAISSPVFSSEDNDQRKWCLKLY
QNGFDEESRDYLSVYLALLSCPKIPTWAKFQFWILDDKGEKRNNVESQSVKSFLPYEHRG
FKKFIPREFLLSRAQWLLPDGRLTLFCKVSMGHDVFSLSRQLSTIKVPSCSLTDELGELW
ENSLFTDCCLLVSGQEFWAHKAILAIRSPVFRAMFQHDMEERRKNRVEIKDLEPQVFKEM
MGFIYTGKVPNLHTMAIGVLAAADRYGLERLKVLCEDALCRDLSVENAAHTLILADLHSA
EQLKMQALDFITLHASEVSETSGWKVMVDFHPHFLAEVFHALASVQRPFLEPPLKRLKR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgacagaggacctggcagctgagagctggggctccacacatatcaccatcaaaacattt
tcctacaagtggaccatcagtaacttccatttttctctggagggattgagcgaagccatt
agcagtccagttttctcatcagaagacaatgaccaaagaaaatggtgtttgaaattatac
cagaatgggtttgatgaagaaagcagagattacctttcagtttacctggcattgctcagc
tgtccaaagatcccaacttgggcaaagttccagttttggatcttagatgacaaaggagag
aaaagaaataatgtggagagccaaagtgtcaagagtttcctgccatatgaacacagggga
ttcaaaaagttcatccctcgagagttcctcttgtcccgggcccaatggctactacctgat
ggcaggctcacactattttgcaaggtgagtatgggccatgatgtcttcagcctttctcga
cagttatctacaatcaaggttccaagctgttctttaacagatgagcttggagagctgtgg
gaaaattccctcttcacagactgctgcctcttggtatctggtcaggaattctgggctcac
aaggccatcttagcaattcgctctccagttttccgagccatgtttcaacatgacatggag
gagaggcgaaagaaccgagttgagatcaaggacctggaacctcaggtcttcaaggagatg
atgggcttcatttacacagggaaggtaccaaacctccacaccatggccattggtgtgctg
gcagctgctgacaggtatggcctggagcgcttgaaagtcctgtgtgaggatgcactctgc
agggatctctcagtggagaatgctgctcacactctcatcctggctgacctccacagtgca
gagcagctgaaaatgcaggcactggatttcattacacttcatgcttctgaggtttctgag
acctctgggtggaaggtcatggtggatttccatccccactttctggctgaagtattccat
gccctggcttctgtacagagacctttcctggaaccccctctcaaacgcctgaagagatag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110544627
Entry
110544627         CDS       T05884                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: speckle-type POZ protein-like
  KO
K10523  speckle-type POZ protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110544627
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110544627
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110544627
SSDB
Motif
Pfam: BTB
Other DBs
NCBI-GeneID: 110544627
NCBI-ProteinID: XP_021486208
LinkDB
Position
Unknown
AA seq 288 aa
RDYLSVYLVLLSCPKSPTWAKFQFCILDANGEKRNNVESQGVNSFLPYQHRGFKKFIPRD
FLLSQAQWLLPNGRLTLFCKVSMGQDIFSNSGQTSAIKVPSCSLTDELGELWENSLFRDC
CLLVSGQEFWAHKAILAARSPVFRAMFXHDLEEGQKNRVEIKDLEPQVFKEMMGFIYTGK
APNLHTMATDVLAAADRYGLESLKVMCEDALCRDLFVENASHTLILADLHSAEQLKMQTL
DFITLHASEVSETLGWKVMVDFHPHLLAEAFHALASAQRPFLNILSNI
NT seq 867 nt   +upstreamnt  +downstreamnt
agagattacctttcagtttacctggtgttgctcagctgtccaaagagccccacttgggca
aagttccagttttgtatcttagatgccaatggggagaaaagaaataatgtggagagccaa
ggtgtcaatagtttcctgccataccaacacaggggattcaaaaagttcatacctcgagat
ttcctcttgtcccaggcccaatggctactccctaatgggaggctcactctcttctgcaag
gtgagtatgggccaagatatctttagtaattctggacagacatctgcaatcaaggttcca
agctgctctttgacagatgagctaggagagctgtgggagaattccctcttcagagactgc
tgtctcttggtatctggtcaggaattctgggctcacaaggctatcttagcagctcgctct
ccagttttcagagccatgttttaacatgatttggaggaggggcaaaagaaccgagttgag
atcaaggacctggagcctcaggtcttcaaggagatgatgggcttcatttacacagggaag
gcaccaaacctccacaccatggccactgatgtgctggcagctgctgacaggtatggcctg
gagagcttgaaggtcatgtgtgaggatgccctctgcagggacctcttcgtggagaatgcc
tctcacactctcatcctggctgacctccacagtgcagagcagctgaaaatgcagacacta
gatttcattacacttcatgcttctgaggtctctgagaccttggggtggaaggtcatggtg
gatttccatccccacttgctggctgaagcattccatgccctggcttctgcacagaggccc
ttcctgaatatcctctcaaacatctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110544797
Entry
110544797         CDS       T05884                                 

Definition
(RefSeq) TD and POZ domain-containing protein 1-like
  KO
K10523  speckle-type POZ protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110544797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110544797
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110544797
SSDB
Motif
Pfam: BTB
Other DBs
NCBI-GeneID: 110544797
NCBI-ProteinID: XP_021486307
LinkDB
Position
Unknown
AA seq 213 aa
MTEDLAAESWGSTHITIKTFSYKWTISNFHFSLEGLREVISSPVFSSEDNDQTKWCLKLY
QNGFDEKSRDYLLVYLALLSCPKSSTWAKFQFWILDDNGEKRNNVESQNVKGFLPYQHWG
FKKFLPREFLLSQAQWLLPDGRLTLFCKVSMGQDVVSLSLQTSAINIPRCSLIDELGALW
ENLHFTDCCLLVSGQEFWAHKIISAARSPVFRA
NT seq 641 nt   +upstreamnt  +downstreamnt
atgacagaggacctggcagctgagagctggggctccacacatattaccatcaagacattt
tcctacaagtggacaatcagtaacttccatttttctctggagggattgagagaagtcata
agcagtccagttttctcatcagaagacaatgaccaaacaaaatggtgtttgaaattatat
cagaatgggtttgatgaaaaaagcagagattaccttttagtttacctggcattgctcagc
tgtccaaagagctccacttgggcaaagttccagttttggattttagatgacaatggggag
aaaagaaataatgtggagagccaaaatgtcaagggtttcctgccataccaacactgggga
ttcaaaaagttcctccctcgagagttcctcctgtcccaggcccaatggctactacctgat
ggcaggctcacactcttttgcaaggtgagtatgggccaagatgttgtcagcctttctcta
cagacatctgcaatcaacattccaaggtgctctttgatagatgagctgggagcactgtgg
gagaatttacacttcacagactgctgcctcttggtatctggtcaggaattctgggctcac
aagatcatctcagcagctcgctctccagttttcagagccat

KEGG   Meriones unguiculatus (Mongolian gerbil): 110551210
Entry
110551210         CDS       T05884                                 

Gene name
Spop
Definition
(RefSeq) speckle-type POZ protein
  KO
K10523  speckle-type POZ protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110551210 (Spop)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110551210 (Spop)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110551210 (Spop)
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 110551210
NCBI-ProteinID: XP_021497313
LinkDB
Position
Unknown
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagggttccaagtcctccacctccggcagaaatgtcgagtggtcccgtggctgag
agctggtgctatacacagatcaaggtagtgaaattctcctacatgtggaccatcaataac
tttagtttttgccgggaggaaatgggtgaagtcataaaaagttcaactttttcatcagga
gccaatgataaactgaaatggtgtttgcgagtaaacccgaaagggctagatgaagaaagc
aaagattacctgtcgctttatctgctgttggtcagctgtccaaagagtgaagttcgagca
aagttcaagttctccatcctgaatgccaagggagaagaaaccaaagctatggagagtcag
cgagcttataggttcgtgcaaggcaaagactggggattcaaaaaattcatccgtagagat
tttctcttggacgaggccaatgggcttctccctgatgacaagctcaccctcttctgcgag
gtgagtgtagtacaagattctgtcaatatttctggacagaataccatgaacatggtaaag
gttcctgagtgccggttggcagatgagttaggagggctgtgggagaattcccgattcaca
gactgctgcttgtgtgtggctggccaggaattccaggctcacaaggctatcttagcagct
cggtctccagttttcagtgccatgtttgaacatgaaatggaggagagcaaaaagaatcgg
gttgaaattaacgatgtagaacctgaagtttttaaggaaatgatgtgcttcatctacacg
gggaaagcgccaaaccttgacaaaatggctgatgatttgctggcagctgctgacaagtac
gccctggagcgcttgaaggtcatgtgcgaggacgccctctgcagtaacctctccgtggag
aacgctgcagaaattctcatcctggctgacctccacagtgccgatcaactgaaaactcag
gcagtggatttcatcaactatcatgcttcggatgtcttggagacctctgggtggaagtca
atggtggtgtcacatccccacttagtggctgaagcttaccgctctctggcttcagcacaa
tgccctttcctgggccccccacgcaaacgcctgaagcaatcctaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110556457
Entry
110556457         CDS       T05884                                 

Definition
(RefSeq) speckle-type POZ protein-like isoform X1
  KO
K10523  speckle-type POZ protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110556457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110556457
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110556457
SSDB
Motif
Pfam: BTB
Other DBs
NCBI-GeneID: 110556457
NCBI-ProteinID: XP_021505894
LinkDB
Position
Unknown
AA seq 251 aa
MKLTVSYQMTSLPYSVSISNTACRRGGSIALPSLKNWHLPLHCKWCCRQVSVVQDSVNVS
GHTNTNTLKVPECRLAEDLARSPVFNAMFEHEMEEYTKNRVEINDLDPEVFKEMMRFVYT
GKAPNLDKMADDLLAAADKYALGRLKVMCEEALCSGLSVENVADTLILADLHGAEQLKAQ
AIDFINRCSVLRQLGCKDGKNWNNQATDIMETSGWKAMIQSHPHLVAEAFRALASGQCPQ
FGIPRKRLKQS
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaagctaacggtctcttaccagatgacaagcttaccttattctgtgagcatctccaac
actgcttgcagaagaggaggaagcattgcactgccctccctaaagaactggcacctcccc
ctccactgcaagtggtgctgtagacaggtgagtgtagttcaagattcagtaaatgtatca
ggacatactaatacaaacactttgaaggtgcccgaatgtcgactagcagaagatttagct
cgatccccggtttttaatgcaatgtttgaacatgaaatggaagaatacacaaagaatcga
gtggaaataaatgatttagatcctgaggtttttaaagaaatgatgagatttgtttacacg
ggaaaagcaccgaatcttgataaaatggcagacgacttgttggcagctgcagacaaatat
gcactgggacgactgaaggtcatgtgtgaagaagctttgtgtagtggcctctcagtagag
aatgttgctgacacccttatccttgcagatttgcatggcgcagaacagctgaaagcccag
gcaatagactttattaacaggtgcagtgttcttcgacaacttggatgtaaggatgggaaa
aactggaacaaccaagcaactgacataatggaaacatcagggtggaaggccatgattcag
tcgcatcctcatttagtggcagaagccttccgcgcactagcgtctggacagtgtccacag
tttggtattccacgcaaaaggctaaagcagtcttga

DBGET integrated database retrieval system