KEGG   Meriones unguiculatus (Mongolian gerbil): 110541303
Entry
110541303         CDS       T05884                                 

Gene name
Ifnb1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04668  TNF signaling pathway
mun05135  Yersinia infection
mun05142  Chagas disease
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110541303 (Ifnb1)
   04668 TNF signaling pathway
    110541303 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    110541303 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110541303 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110541303 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110541303 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    110541303 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    110541303 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    110541303 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    110541303 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110541303 (Ifnb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110541303 (Ifnb1)
   05152 Tuberculosis
    110541303 (Ifnb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110541303 (Ifnb1)
   05161 Hepatitis B
    110541303 (Ifnb1)
   05160 Hepatitis C
    110541303 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    110541303 (Ifnb1)
   05164 Influenza A
    110541303 (Ifnb1)
   05162 Measles
    110541303 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    110541303 (Ifnb1)
   05163 Human cytomegalovirus infection
    110541303 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110541303 (Ifnb1)
   05169 Epstein-Barr virus infection
    110541303 (Ifnb1)
   05165 Human papillomavirus infection
    110541303 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110541303 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110541303 (Ifnb1)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interferons
   110541303 (Ifnb1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110541303
NCBI-ProteinID: XP_021483747
LinkDB
Position
Unknown
AA seq 185 aa
MTDRWIHHVALLLCFSTTALSIDYRKLQLQQSNVTSTCQELLKQLDQNICLNDRLEFKIP
VAVKHPQQMEKSYTAFTIQQMLQNIFLLFKTDFSSTGWNNTIIESLLGILSAQAESLETI
LKEKQEKEKLAWVTAPTTSRLKSYYWRVQKFLENKRYSRCAWMVVHAEISRNFYMIEKMT
KNFQS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccgacaggtggatccatcatgtcgcgctcctgctgtgcttctccaccacagccctc
tccatcgactacagaaagcttcagctccaacaaagcaacgtcacttcgacatgccaggag
ctcctgaaacagctggatcaaaacatctgcctcaacgacaggctggaattcaagatccct
gtggcggtgaagcacccacaacagatggagaagagttacactgccttcaccattcaacag
atgctccagaacatctttcttctcttcaaaacagatttctccagcactggatggaataac
accatcattgaaagcctcttgggtatactcagtgcgcaggcagagtctctggagacaatt
ctcaaagaaaagcaagagaaggaaaaactggcttgggtgactgccccaactacttcacgc
ttgaagagctattactggagggtgcaaaagttccttgaaaacaagaggtacagccgctgc
gcctggatggtggtccacgcagaaatctccaggaacttttacatgattgaaaaaatgact
aagaacttccagagctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543198
Entry
110543198         CDS       T05884                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110543198
   04151 PI3K-Akt signaling pathway
    110543198
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110543198
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110543198
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110543198
   04621 NOD-like receptor signaling pathway
    110543198
   04622 RIG-I-like receptor signaling pathway
    110543198
   04623 Cytosolic DNA-sensing pathway
    110543198
   04650 Natural killer cell mediated cytotoxicity
    110543198
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110543198
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110543198
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110543198
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110543198
   05161 Hepatitis B
    110543198
   05160 Hepatitis C
    110543198
   05171 Coronavirus disease - COVID-19
    110543198
   05164 Influenza A
    110543198
   05162 Measles
    110543198
   05168 Herpes simplex virus 1 infection
    110543198
   05163 Human cytomegalovirus infection
    110543198
   05167 Kaposi sarcoma-associated herpesvirus infection
    110543198
   05169 Epstein-Barr virus infection
    110543198
   05165 Human papillomavirus infection
    110543198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110543198
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interferons
   110543198
SSDB
Motif
Pfam: Interferon RIX1
Other DBs
NCBI-GeneID: 110543198
NCBI-ProteinID: XP_021485269
LinkDB
Position
Unknown
AA seq 185 aa
MSKPCAFLTVLVVLSCWSTCSLGCDLPHTHNLRNKGALTLLAQMRRLSPVFCLKDRKDFG
FPLEKEDVQQIQKTQAIPVLNELTQQVLSLFSSKDSSSAWETTLLDTFCSGLHQQLQDLQ
VCLRQQVGVQESPLTQEDPVEAVRKYFHRITVYLREKKHSPCAWEVVRAQVWRALSSSAH
WLARR
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtcgaagccctgtgccttcctgacggtcctggtggtgctgagctgctggtcaacctgc
tctctaggatgtgacctgcctcacacacataacctcaggaacaagggagccttgacactc
ctggcacaaatgaggagactctcccctgtcttctgcctcaaggacagaaaggactttgga
ttccctctggagaaggaggatgtccagcagatccagaagactcaagccatccctgtcctg
aatgagctgacccagcaggtcctgagcctcttcagctcaaaggactcctcttctgcttgg
gagacaaccctcctagacacattctgcagcggcctccaccagcagctccaggacctgcag
gtctgtctgaggcagcaggtcggggtgcaggaatctcccctgacccaggaagaccccgtg
gaggctgtgaggaagtacttccacaggatcactgtctacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcacaagtgtggagagccctgtcttcctcagcccac
tggctggccagacgg

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543200
Entry
110543200         CDS       T05884                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110543200
   04151 PI3K-Akt signaling pathway
    110543200
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110543200
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110543200
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110543200
   04621 NOD-like receptor signaling pathway
    110543200
   04622 RIG-I-like receptor signaling pathway
    110543200
   04623 Cytosolic DNA-sensing pathway
    110543200
   04650 Natural killer cell mediated cytotoxicity
    110543200
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110543200
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110543200
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110543200
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110543200
   05161 Hepatitis B
    110543200
   05160 Hepatitis C
    110543200
   05171 Coronavirus disease - COVID-19
    110543200
   05164 Influenza A
    110543200
   05162 Measles
    110543200
   05168 Herpes simplex virus 1 infection
    110543200
   05163 Human cytomegalovirus infection
    110543200
   05167 Kaposi sarcoma-associated herpesvirus infection
    110543200
   05169 Epstein-Barr virus infection
    110543200
   05165 Human papillomavirus infection
    110543200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110543200
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interferons
   110543200
SSDB
Motif
Pfam: Interferon RIX1
Other DBs
NCBI-GeneID: 110543200
NCBI-ProteinID: XP_021485270
LinkDB
Position
Unknown
AA seq 183 aa
LTVLVVLSCWSTCSLGCDLPHTHNLRNKRALTLLAQMRRLSPVSCLKDRKDFGFPLEKEN
VQQIQKTQAIPVLNELTQQVLSLFSSKDSSSPWKTTLLDTFCSGLLQQLQDLQACLRQQV
GVQESPLTQEDPVEAVRKYFHRITVYLREKKRSPCAWEVVRVQVWRALSSSAHWLARRRE
EED
NT seq 552 nt   +upstreamnt  +downstreamnt
ctgacggtcctggtggtgctgagctgctggtcaacctgctctctaggatgtgacctgcct
cacacacataacctcaggaacaagagagccttgacactcctggcacaaatgaggagactc
tcccctgtctcctgcctcaaggacagaaaggactttggattccctctggagaaggagaat
gtccagcagatccagaagactcaagccatccctgtcttgaatgagctgacccagcaggtc
ctgagcctcttcagctcaaaggactcctcttctccttggaagacaaccctcctagacaca
ttctgcagcggcctcctccagcagctccaggatctgcaggcctgtctgaggcagcaggtg
ggggtgcaggaatctcccctgacccaggaggaccccgtggaggctgtgaggaaatacttc
cataggatcactgtctacctgagagagaagaaacgcagcccctgtgcctgggaggttgtc
agagtacaagtgtggagagccctgtcttcctcagcccactggctggccagacggagagag
gaggaggactga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110544130
Entry
110544130         CDS       T05884                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110544130
   04151 PI3K-Akt signaling pathway
    110544130
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110544130
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110544130
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110544130
   04621 NOD-like receptor signaling pathway
    110544130
   04622 RIG-I-like receptor signaling pathway
    110544130
   04623 Cytosolic DNA-sensing pathway
    110544130
   04650 Natural killer cell mediated cytotoxicity
    110544130
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110544130
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110544130
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110544130
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110544130
   05161 Hepatitis B
    110544130
   05160 Hepatitis C
    110544130
   05171 Coronavirus disease - COVID-19
    110544130
   05164 Influenza A
    110544130
   05162 Measles
    110544130
   05168 Herpes simplex virus 1 infection
    110544130
   05163 Human cytomegalovirus infection
    110544130
   05167 Kaposi sarcoma-associated herpesvirus infection
    110544130
   05169 Epstein-Barr virus infection
    110544130
   05165 Human papillomavirus infection
    110544130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110544130
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interferons
   110544130
SSDB
Motif
Pfam: Interferon Med9 RIX1
Other DBs
NCBI-GeneID: 110544130
NCBI-ProteinID: XP_021485910
LinkDB
Position
Unknown
AA seq 190 aa
MSKPCAFLTVLVVLSCWSTCSLGCDLPHTHNLRNKRALTLLAQMRRLSPVSCLKDRKDFG
FPLEKENVQQIQKTKAIPVLNELTQQVLSLFCSKDSSSAWETTLLDTFCSGLHKQLQDLK
ACLRQQVGVQESPLTQEDPVEAVRKYFHRITVYLREKKHSPCAWEVVRAQVWRALSSSAH
WLARRREEKD
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtcgaagccctgtgccttcctgacggtcctggtggtgctgagctgctggtcaacctgc
tctctaggatgtgacctgcctcacacacataacctcaggaacaagagagccttgacactc
ctggcacaaatgaggagactctctcctgtctcctgcctcaaggacagaaaggactttgga
ttccctctggagaaggagaatgtccagcagatccagaaaactaaagccatccctgtcctg
aatgagctgacccagcaggtcctgagcctcttctgctcaaaggactcttcttctgcttgg
gagacaaccctcctagacacattctgcagcggcctccacaagcagctccaagacctgaag
gcctgtctgaggcagcaggtcggggtgcaggaatctcccttgacccaggaggaccccgtg
gaggctgtgaggaagtacttccacaggatcactgtctacctgagagagaagaaacacagc
ccctgtgcctgggaagtggtcagagcacaagtgtggagagccctgtcttcctcagcccac
tggctggccagacggagagaggagaaggactga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110544619
Entry
110544619         CDS       T05884                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110544619
   04151 PI3K-Akt signaling pathway
    110544619
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110544619
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110544619
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110544619
   04621 NOD-like receptor signaling pathway
    110544619
   04622 RIG-I-like receptor signaling pathway
    110544619
   04623 Cytosolic DNA-sensing pathway
    110544619
   04650 Natural killer cell mediated cytotoxicity
    110544619
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110544619
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110544619
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110544619
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110544619
   05161 Hepatitis B
    110544619
   05160 Hepatitis C
    110544619
   05171 Coronavirus disease - COVID-19
    110544619
   05164 Influenza A
    110544619
   05162 Measles
    110544619
   05168 Herpes simplex virus 1 infection
    110544619
   05163 Human cytomegalovirus infection
    110544619
   05167 Kaposi sarcoma-associated herpesvirus infection
    110544619
   05169 Epstein-Barr virus infection
    110544619
   05165 Human papillomavirus infection
    110544619
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110544619
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interferons
   110544619
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110544619
NCBI-ProteinID: XP_021486202
LinkDB
Position
Unknown
AA seq 190 aa
MSKPCAFLTVLVVLSYWSTCSLGCDLPHTHNLKNNSALTLLEQMRRLSPVSCLKDRKDFG
FPLEKENIQQIQETQAIPVLNELTQQVLSLFCQKDSSSPWKTTLLDTFCTGLLLQLKDLQ
ACLRQQVGVQESPLTQEDPVEAVRKYFDRITVYLREKKRSPCAWEVVRVQVWRALSSSAH
WLARRRDEED
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtcgaagccctgtgcctttttgacggtcctggtggtgctgagctactggtcaacctgc
tctctaggatgtgacctgcctcacacacataacctgaagaacaacagtgccttgacactc
ctggaacaaatgaggagactctcccctgtctcctgcctcaaggacagaaaggactttgga
ttccctctggagaaggagaatatccagcagatccaggagacccaagccatccctgtcctg
aatgagctgacccagcaggtcctgagcctcttctgccaaaaggactcctcttctccttgg
aagacaaccctcctagacacattctgcaccggcctcctcctgcagctcaaggacctgcag
gcctgtctgaggcagcaggtcggggtgcaggaatctcccctgacccaggaggaccccgtg
gaggctgtgaggaagtacttcgacaggatcactgtctacctgagagagaagaaacgcagc
ccctgtgcctgggaggtggtcagagtacaagtgtggagagccctgtcttcctcagcccac
tggctggccagacggagagatgaggaggactga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110544870
Entry
110544870         CDS       T05884                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110544870
   04151 PI3K-Akt signaling pathway
    110544870
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110544870
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110544870
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110544870
   04621 NOD-like receptor signaling pathway
    110544870
   04622 RIG-I-like receptor signaling pathway
    110544870
   04623 Cytosolic DNA-sensing pathway
    110544870
   04650 Natural killer cell mediated cytotoxicity
    110544870
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110544870
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110544870
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110544870
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110544870
   05161 Hepatitis B
    110544870
   05160 Hepatitis C
    110544870
   05171 Coronavirus disease - COVID-19
    110544870
   05164 Influenza A
    110544870
   05162 Measles
    110544870
   05168 Herpes simplex virus 1 infection
    110544870
   05163 Human cytomegalovirus infection
    110544870
   05167 Kaposi sarcoma-associated herpesvirus infection
    110544870
   05169 Epstein-Barr virus infection
    110544870
   05165 Human papillomavirus infection
    110544870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110544870
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interferons
   110544870
SSDB
Motif
Pfam: Interferon MHC_I_3
Other DBs
NCBI-GeneID: 110544870
NCBI-ProteinID: XP_021486342
LinkDB
Position
Unknown
AA seq 146 aa
MGGVLLMGSLDCGELKSLPAHQCLPDRNDFRRPWKKGAVSREEWQEATCCYPEVRRQVLH
LFGSEASRDAWPQLLTNMHSDHLQDTQQGPAQTCPPPFPTDIRKYFERISSYLKAKGYSP
CSWEIVTTEIQAALSGFPGSHERSQD
NT seq 441 nt   +upstreamnt  +downstreamnt
atgggaggggtgctgctgatgggctcccttgattgtggagagctgaagagcttacccgct
caccagtgcctgccggacagaaacgatttccgacgtccctggaagaaaggagctgtctcc
cgggaggagtggcaggaagccacctgttgctaccccgaggtgcgcaggcaggtcctccac
ctcttcggctcagaggccagcagagacgcctggccacagctactcactaatatgcacagt
gaccacctgcaagacactcaacaggggccggcgcaaacctgtccgccacctttccccaca
gacatccgcaagtacttcgaaaggatctccagctacctgaaggccaagggatacagccct
tgctcctgggagatcgtcacgacagaaatacaagcggcgctttccgggttcccagggtca
cacgaaaggagccaagattga

DBGET integrated database retrieval system