KEGG   Meriones unguiculatus (Mongolian gerbil): 110541615
Entry
110541615         CDS       T05884                                 

Gene name
Msn
Definition
(RefSeq) moesin
  KO
K05763  moesin
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04530  Tight junction
mun04670  Leukocyte transendothelial migration
mun04810  Regulation of actin cytoskeleton
mun05162  Measles
mun05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110541615 (Msn)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110541615 (Msn)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110541615 (Msn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110541615 (Msn)
  09172 Infectious disease: viral
   05162 Measles
    110541615 (Msn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mun04812]
    110541615 (Msn)
   04147 Exosome [BR:mun04147]
    110541615 (Msn)
Cytoskeleton proteins [BR:mun04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     110541615 (Msn)
Exosome [BR:mun04147]
 Exosomal proteins
  Proteins found in most exosomes
   110541615 (Msn)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 110541615
NCBI-ProteinID: XP_021484010
LinkDB
Position
Unknown
AA seq 547 aa
FQVVKTIGLREVWFFGLQYQDTKAFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVS
EELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGE
KLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKN
KKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFY
APRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERALLENEKKKR
ELAEKEKEKIEREKEELMEKLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLA
KERQEAEEAKEALLQASRDQKKTQEQLASEMAELTARISQLEMARKKKESEAVEWQQKAQ
MVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTT
EAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQR
IDEFESM
NT seq 1644 nt   +upstreamnt  +downstreamnt
ttccaggtggtgaaaactattggcttaagggaagtttggttctttgggctgcagtaccag
gacacaaaagctttctctacttggctgaaactcaataagaaggtgactgcacaggatgtg
cggaaggaaagcccgttgctcttcaagttccgggccaagttctacccagaggatgtatct
gaagaactgatccaggatatcacccagcgcctgttctttctgcaagtaaaggagggcatt
ctcaatgatgacatttattgcccacctgaaactgctgtgctgttggcgtcctatgccgtc
cagtctaaatacggtgacttcaataaggaagtgcacaagtctggctacctggctggagag
aagttgctgccccagagagtcttggagcagcacaaactcaacaaggaccagtgggaagag
aggatccaggtgtggcatgaggaacaccggggcatgctcagggaagatgctgtcctggaa
tacctcaagattgctcaagacctggagatgtatggtgtgaactatttcagcatcaagaac
aagaaaggctcagagctatggctaggtgtggatgccttaggtcttaacatctatgagcag
aatgacagactgactcctaagattggcttcccttggagtgaaatcaggaatatttccttc
aatgataagaaatttgtcatcaagcctattgacaaaaaagctccggactttgtgttctat
gctccccggcttcggattaacaagaggatcttggccctgtgcatggggaatcatgagctg
tacatgcgtcggcgtaagcctgacaccatcgaggtgcagcagatgaaggcacaggcccgg
gaagagaagcaccagaagcagatggaacgtgctctactggaaaatgagaagaagaagcgt
gagctggctgaaaaagagaaggagaagattgaacgggagaaggaagagctgatggagaag
ctgaagcagattgaggagcagactaagaaggctcagcaagaactggaagaacagacccgc
agagccctagaacttgagcaggaacggaaacgtgcccagagtgaggctgaaaagctggcc
aaggagcgtcaagaagctgaagaggccaaggaggccctccttcaggcttctcgggaccag
aagaagacccaggaacagctggcttcagaaatggcagagctgacagcacggatctctcag
ttggaaatggctagaaagaagaaggagagtgaggctgtggaatggcagcaaaaggcccag
atggtccaggaagacttggagaagactcgtgctgagctgaagactgccatgagtacacct
catgtggcagagcctgctgagaatgaacaggacgaacaggatgagaatggggcagaggcc
agtgctgacctgcgggctgatgctatggccaaggaccgtagtgaggaggaacgtactact
gaggctgagaagaatgagcgtgtgcagaagcatcttaaggctcttacttcagagttggcc
aatgcccgagatgagtccaagaagactgccaatgatatgatccatgctgagaacatgcgg
ctgggacgagacaaatacaagaccttgcgccagatccggcagggcaataccaaacagcgc
attgatgaatttgagtccatgtag

DBGET integrated database retrieval system