KEGG   Meriones unguiculatus (Mongolian gerbil): 110541673
Entry
110541673         CDS       T05884                                 

Gene name
Ifngr2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04066  HIF-1 signaling pathway
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05200  Pathways in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110541673 (Ifngr2)
   04066 HIF-1 signaling pathway
    110541673 (Ifngr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110541673 (Ifngr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110541673 (Ifngr2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110541673 (Ifngr2)
   04658 Th1 and Th2 cell differentiation
    110541673 (Ifngr2)
   04659 Th17 cell differentiation
    110541673 (Ifngr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110541673 (Ifngr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110541673 (Ifngr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110541673 (Ifngr2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110541673 (Ifngr2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110541673 (Ifngr2)
  09172 Infectious disease: viral
   05164 Influenza A
    110541673 (Ifngr2)
   05168 Herpes simplex virus 1 infection
    110541673 (Ifngr2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110541673 (Ifngr2)
   05140 Leishmaniasis
    110541673 (Ifngr2)
   05142 Chagas disease
    110541673 (Ifngr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110541673 (Ifngr2)
Cytokine receptors [BR:mun04050]
 Interleukin receptor families
  IFN receptor family
   110541673 (Ifngr2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 110541673
NCBI-ProteinID: XP_021484063
LinkDB
Position
Unknown
AA seq 392 aa
MEAWASQSQVQPQAIDLDSCAVSSHDLFYQLEPADTLKCFCNSVFSSDFLPLPTHSLLSF
PIDLIPIPYLPHSPSFPIHPILPLIPYPSQDPSFQLAAPLHSKIHLYNEEQILTWEPPLP
SNDTRPVVYQVEYRRIGASWNTLHWVNCTDTPETKCDISGGLPRYHKVFLRVRATLGEHS
SDWVYLDPFIHYRNATIGPPKNISVIPEEGSLMIHFSPPFNVVGEATFQYRVYYWEKTGT
QQVKGPFKGNSIVLDNLKPFRVYCLQTEAQLILKDNTVRPPGLLSNVSCHETAADASIRL
LQVILIPVGVFTLPLLLTGACFVLFLRYQSRVKYWFQAPPNIPEQIKEYLKDPDQYILEA
LDKDPSPKDDAWDSVSIIFFPEKEQDDALQTL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggaggcttgggcatcccagagtcaagtgcagccacaagccatagatctggattcctgt
gcagtcagttcccacgacctgttctaccagctggagcctgcagacacactgaagtgtttt
tgtaattcagtgttctcttctgattttctccctctcccgacccattccctcctctcattc
cctattgacctcatccccattccctacctgccccattctccctcattccctattcaccct
attctccctctcattccctatccttctcaagacccctctttccagcttgctgctcctctg
cactccaaaattcacctgtacaatgaagagcagatcctgacttgggagccaccgctcccc
agcaatgacacgagaccagtggtctaccaagtggagtaccgccgcattggcgcttcttgg
aatacattgcactgggtgaactgtaccgacaccccggagacaaagtgtgacatctcagga
ggcttgccacgctaccataaagtcttcttgcgtgttcgagccacgctcggagagcacagt
tccgactgggtgtacctggatccgttcatacactatcggaatgctactattgggcctcca
aagaacatctctgtgatcccagaagagggctccctcatgatccacttctcccctcccttt
aatgtggtcggggaggcaacttttcagtatcgtgtctactactgggagaaaacaggaacc
caacaggtgaaaggccctttcaagggcaattccattgtgctggataacttgaagccattc
agagtgtactgtttacaaactgaggcacagctgattttgaaagacaacactgtccgtcca
cctgggctattaagcaacgtgtcttgtcatgaaacagcggcagatgcctccatcaggcta
ctgcaggtcatcctgatccccgtgggggtcttcacattgccgctgctgctgacgggagcc
tgcttcgtcctgttcctcagataccaaagccgggtgaaatactggtttcaagctccaccc
aacatcccagaacaaataaaagagtatttaaaggacccagatcaatacatcttagaagcc
ttggacaaggacccttcaccaaaggatgatgcctgggactccgtgtcaatcattttcttt
ccagaaaaggagcaagatgatgctctccaaacactatga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110557641
Entry
110557641         CDS       T05884                                 

Gene name
Ifngr1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04066  HIF-1 signaling pathway
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05164  Influenza A
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05200  Pathways in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110557641 (Ifngr1)
   04066 HIF-1 signaling pathway
    110557641 (Ifngr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110557641 (Ifngr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110557641 (Ifngr1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110557641 (Ifngr1)
   04658 Th1 and Th2 cell differentiation
    110557641 (Ifngr1)
   04659 Th17 cell differentiation
    110557641 (Ifngr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110557641 (Ifngr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110557641 (Ifngr1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110557641 (Ifngr1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110557641 (Ifngr1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110557641 (Ifngr1)
  09172 Infectious disease: viral
   05164 Influenza A
    110557641 (Ifngr1)
   05168 Herpes simplex virus 1 infection
    110557641 (Ifngr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110557641 (Ifngr1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110557641 (Ifngr1)
   05140 Leishmaniasis
    110557641 (Ifngr1)
   05142 Chagas disease
    110557641 (Ifngr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110557641 (Ifngr1)
   04090 CD molecules [BR:mun04090]
    110557641 (Ifngr1)
Cytokine receptors [BR:mun04050]
 Interleukin receptor families
  IFN receptor family
   110557641 (Ifngr1)
CD molecules [BR:mun04090]
 Proteins
  110557641 (Ifngr1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 110557641
NCBI-ProteinID: XP_021507819
LinkDB
Position
Unknown
AA seq 475 aa
MDPQAAARSMLLLAVLMLSAGPGSGAVASTEDPEPSSVPVPTNVLITSYNMNPILCWKYQ
NMSQTPFFTVQVKNYGSKWIDSCTNISDHCCNIYEEIANPDESVWARVKAKVGQKESVYA
ESKEFIICRQGKVGPPGLDIRRKEDWLVVHVFHPEVIINGERLGVMFDDISTCHTFDYTL
YVKNITGGKILEKKHEVDIEDCNETLCQLSILVSTLDTEYCASVDGHSKYWNVRTEKSED
VCISLFHNNKKDSIWILVVAPFIILIIVILVFVYWHIKKNPSKRKSIMLPKSLLSVVRNV
TSETKPESKYVSLVTTCQPALLENERVILEERLSTTTALDKPGAAEHELSKEAEAMITEG
STSPVTPDSPPTPIRRGSSFHLSSDQSGPCSTATCHSRHGSDSGLVGSGSSGSDSEVLPH
TPETKAVGQDPTPVRKAPTSFGYDKPHVLVDVPVDGGGKESLIGYRLTGDAPELC
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggacccgcaggccgcagcgcgcagcatgcttctgctcgcggtcctgatgctgtctgcg
gggcccgggagcggagctgtggctagcacggaggatccggagccgtcctcggttcctgta
ccaacgaatgttctaattacctcctataacatgaaccctatcctatgctggaaataccag
aacatgtcacagactcccttttttactgtacaggtaaagaattatggaagtaaatggatt
gattcttgcaccaacatttctgatcattgttgtaatatctatgaagaaattgctaatcct
gatgaatctgtctgggccagagttaaagctaaggttggacagaaagaatctgtctatgca
gagtcaaaagagtttattatatgccgacaaggaaaagttggaccacctggcctggacatc
agaaggaaggaagactggctcgttgtccatgtgtttcaccccgaggttattataaatgga
gaaaggcttggagtgatgtttgatgatattagcacctgtcacacattcgactacacactg
tatgtgaaaaatattacaggtggaaagatcctagagaagaagcatgaggttgatatagaa
gattgtaatgagactctgtgccagttaagcatcctcgtgtccacactggacaccgaatac
tgtgcttccgtagatgggcactcaaaatactggaatgttagaacagaaaagtcggaagac
gtctgtatttcccttttccataacaacaaaaaagattcaatttggattctggttgttgct
ccttttatcatccttataatagttatcctggtatttgtatattggcatattaagaagaat
ccatctaagagaaaaagcataatgttacctaagtccttgctctctgtggtaagaaatgtc
acttcagagacaaaacctgaatcaaaatatgtgtcacttgtgacaacgtgccagccagct
ctccttgagaacgagagagtgatccttgaagaacgcttgtccacaaccacggctctagac
aagccaggagccgcagaacacgaactttcaaaagaagcagaggccatgatcactgaagga
agcacgtctcctgtgacccctgacagtcctccaactccaatacgaagaggcagttctttc
catttaagtagtgaccagtcaggcccctgcagcaccgccacctgtcactccagacacggc
tccgacagtggcctggtgggatcaggcagctctggatctgactctgaagttctcccacat
accccagaaacaaaggctgtagggcaagatcccacacccgtgagaaaggcccccacctct
tttggttatgataaaccgcacgtgttggtggatgtgcccgtggatggcggcgggaaagag
tccttgattgggtacagactcacaggagatgcccctgaactgtgctaa

DBGET integrated database retrieval system