KEGG   Meriones unguiculatus (Mongolian gerbil): 110541773
Entry
110541773         CDS       T05884                                 

Gene name
Tlr2
Definition
(RefSeq) toll-like receptor 2
  KO
K10159  toll-like receptor 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04151  PI3K-Akt signaling pathway
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun05132  Salmonella infection
mun05134  Legionellosis
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05144  Malaria
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05162  Measles
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05205  Proteoglycans in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05321  Inflammatory bowel disease
mun05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110541773 (Tlr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110541773 (Tlr2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110541773 (Tlr2)
   04620 Toll-like receptor signaling pathway
    110541773 (Tlr2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110541773 (Tlr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110541773 (Tlr2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110541773 (Tlr2)
   05321 Inflammatory bowel disease
    110541773 (Tlr2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110541773 (Tlr2)
   05134 Legionellosis
    110541773 (Tlr2)
   05152 Tuberculosis
    110541773 (Tlr2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110541773 (Tlr2)
   05161 Hepatitis B
    110541773 (Tlr2)
   05171 Coronavirus disease - COVID-19
    110541773 (Tlr2)
   05162 Measles
    110541773 (Tlr2)
   05168 Herpes simplex virus 1 infection
    110541773 (Tlr2)
   05169 Epstein-Barr virus infection
    110541773 (Tlr2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110541773 (Tlr2)
   05144 Malaria
    110541773 (Tlr2)
   05145 Toxoplasmosis
    110541773 (Tlr2)
   05140 Leishmaniasis
    110541773 (Tlr2)
   05142 Chagas disease
    110541773 (Tlr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110541773 (Tlr2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110541773 (Tlr2)
   04054 Pattern recognition receptors [BR:mun04054]
    110541773 (Tlr2)
   04090 CD molecules [BR:mun04090]
    110541773 (Tlr2)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110541773 (Tlr2)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    110541773 (Tlr2)
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   110541773 (Tlr2)
Pattern recognition receptors [BR:mun04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   110541773 (Tlr2)
CD molecules [BR:mun04090]
 Proteins
  110541773 (Tlr2)
Glycosaminoglycan binding proteins [BR:mun00536]
 Hyaluronan
  Cell surface receptors
   110541773 (Tlr2)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR TIR_2 LRR_5 LRR_1 LRR_9 LRRCT DUF1863
Other DBs
NCBI-GeneID: 110541773
NCBI-ProteinID: XP_021484145
LinkDB
Position
Unknown
AA seq 785 aa
MIPALWTFWTLLAMTGLSKEGCCAQVPLSCDTAGKCDGRSRSFTSIPSGLTAAMKSLDLS
NNKITYIGHEDLRACVSLRALTLESSGINTIEDDAFSSLGSLEHLDLSDNHLSNLSSSWF
RPLSSLKYLNLMGNPYRTLGGTSLFSSLTKLQTLRVGSADAFSGLRRIDFLGLTSLDELE
IKASGLRNYEPKSLKAIQNIHHLTLHLRESTFLLGIFADILSSVRCLELRETSMTSFLFS
ELSANESTSLMKKLAFRNARLTDKSFNEFLKLLPYISELSEVEFDDCTLDGIGNFDPPES
DIVRELGKVETLTIRRLHIPNFYLFYDLHTVYSLLQKVKRITVENSKVFLVPCLFSQNLK
SLEFLDLSENLMVEEYLKNSACEGAWPALQTLILRQNHLRSIERTGEILLTLKNLTALDI
SRNSFGLMPDTCQWPEKMRFLNLSSTGIQAIKACIPPTLEVLDVSNNNLNSFSLLLPWLR
ELHISRNKLKTLPDASFLPVLLVMKISENAISTFSEDQLSSFPNLESLEAGANHFICSCE
FLSFTLGQRPALAQVLVGWPDSYLCDSPPRLHGQKIQDARPSVLECHQAALVSGVCCALL
LMILLIGGLCYHFHGLWYLRMMWAWLQAKRKPKRAPCREVCYDAFVSYSEQDSHWVEHLM
VQRLENGDPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTVFVLSENFVRSDWCKYELDF
SHFRLFEENNDATILVLLEPIEKKAIPQRFCKLRKIMNTKTYLEWPLDAAQQEVFWANLR
TAIKS
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgatacctgctctttggaccttctggactttgctggccatgacaggcctctccaaggaa
ggctgttgtgctcaggttcctctgtcgtgtgacactgctggcaaatgtgatggccgctcc
aggtctttcacctctattccttcaggactcacagcagccatgaagagccttgacctctct
aacaacaagatcacctacattggccatgaggacctgcgggcatgtgtgagcctccgggct
ctgacactggagtccagcggaatcaacaccattgaggatgatgccttttcctccctgggc
agtcttgaacatttggacttgtctgataaccacttgtctaacttatcttcctcctggttc
aggcccctttcctccttgaaatacttaaacttaatgggaaatccttacaggactctgggg
ggaacgtcactgttttctagcctcacaaaattacaaaccctcagagtaggaagtgctgat
gccttcagtgggcttaggagaatagattttcttgggctgacttctctcgacgaacttgaa
attaaagcatcaggtctccggaattatgagcccaaaagtctaaaggcgattcaaaacatc
catcacctgaccctccacctgagggaatctactttcctgttggggatttttgcagacatt
ctgagttctgtgagatgtttggaactgcgggagactagcatgaccagcttcctcttttca
gaactgtctgctaatgaaagcacttcactgatgaaaaagctagcattccgaaatgcacgc
ctcaccgacaaaagctttaatgaatttctgaaactgttgccttacatttcagaactgtcc
gaggtagaatttgatgactgcaccctcgatggaattggcaatttcgacccgccagagtca
gacatcgtgagagagctgggtaaagtggaaacgctaacaatccggaggctgcacatcccg
aacttttacttattttatgatctacatactgtgtattccctcctgcagaaagttaagcga
atcacggtagaaaacagtaaggtttttctggttccttgtttgttttctcagaatttaaaa
tcattagaattcttggacctcagtgaaaatttgatggttgaagaatatttgaaaaactca
gcttgtgagggcgcctggcctgctctacaaaccttaattttgagacagaaccatttgaga
tcaatagaaagaactggagagattttgctgaccctgaaaaacctgacagcccttgacatc
agcaggaacagctttggtcttatgcctgacacttgtcagtggccggagaagatgcgcttc
ctgaacctgtccagtacagggatacaggccataaaagcatgcattcctccgacactagaa
gtgttggatgttagtaacaacaatctcaattcattttctttgctcttgccttggctccga
gagctccatatttccagaaataagctgaagactctcccagatgcctccttcctccctgtg
ttactggtcatgaagatcagcgagaacgcaataagcactttctctgaagaccagcttagt
tcttttcccaacctggagagtctggaagcaggggccaaccacttcatctgctcctgtgaa
tttctgtccttcacgctgggccagaggccagccctggcccaggtcctggtcggctggcca
gacagctacttgtgtgactccccgccccgcctgcatggccagaaaatccaggatgcccgg
ccctcagtcttggagtgccaccaggctgcactggtgtctggtgtctgctgtgcccttctc
ctgatgatcctgctcataggcggcctgtgctaccatttccatgggctgtggtacctgcgg
atgatgtgggcatggcttcaggccaagaggaagcccaagagggctccttgcagggaggtt
tgctatgacgcctttgtttcttacagcgagcaggactcccactgggtggagcacctcatg
gtccagcggctggagaacggtgacccgcccttcaagctgtgtctccacaagcgagacttt
gttcctggcaagtggatcattgacaacatcattgattccattgaaaagagccacaaaacg
gtgttcgtgctttctgagaactttgtgcggagcgattggtgcaaatacgaactggacttc
tcccacttcaggctcttcgaagagaacaatgacgccaccatcctcgttttgctggagccc
atagagaagaaagccatcccccagcgcttctgcaaactgcgcaagataatgaataccaag
acctacctggagtggcccttagatgctgctcagcaggaagtattctgggcaaatctgaga
actgcaataaagtcgtag

DBGET integrated database retrieval system