KEGG   Meriones unguiculatus (Mongolian gerbil): 110541888
Entry
110541888         CDS       T05884                                 

Gene name
Ifnar2
Definition
(RefSeq) interferon alpha/beta receptor 2
  KO
K05131  interferon receptor 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun05160  Hepatitis C
mun05162  Measles
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110541888 (Ifnar2)
   04151 PI3K-Akt signaling pathway
    110541888 (Ifnar2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110541888 (Ifnar2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110541888 (Ifnar2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110541888 (Ifnar2)
   04621 NOD-like receptor signaling pathway
    110541888 (Ifnar2)
   04650 Natural killer cell mediated cytotoxicity
    110541888 (Ifnar2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110541888 (Ifnar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110541888 (Ifnar2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110541888 (Ifnar2)
   05171 Coronavirus disease - COVID-19
    110541888 (Ifnar2)
   05164 Influenza A
    110541888 (Ifnar2)
   05162 Measles
    110541888 (Ifnar2)
   05168 Herpes simplex virus 1 infection
    110541888 (Ifnar2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110541888 (Ifnar2)
   05169 Epstein-Barr virus infection
    110541888 (Ifnar2)
   05165 Human papillomavirus infection
    110541888 (Ifnar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110541888 (Ifnar2)
Cytokine receptors [BR:mun04050]
 Interleukin receptor families
  IFN receptor family
   110541888 (Ifnar2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 110541888
NCBI-ProteinID: XP_021484258
LinkDB
Position
Unknown
AA seq 526 aa
MLPTRTASAISLLNLCLVVYISLQFGPSSAFDEYPEELCTTNLAFRNFRLILSWELKNKS
IPATHYTFNYTIMSKPEEVKVVKNCTDIKESSCDVTDEWSDVTENYAVIILVYRGDSVTS
QCSGSVSYLDVRLEPPEFEIAGSTDHINVVVKFPPVTPKIFGDNLWEMPSYRSFVIEEQM
EDGINKHKVKINNVVGNFTYILRDLLPKTNYCVSVYFEVSGQKATIKSPLKCTLLQPGQE
SGSSESATIGIITGCLIVTVFISTITILKRIGYICLKNNFPNALKFRHFLAWIVPELPPS
EAVSTLEIIPSNKKKKLWNYDYGDESDSDDEEVPKARATGYTMHGLMVKLPSQASDSPDQ
PPEPQPEEDSGTEETYEAGAGAGAELELPTEAEVGPGLGPSEDPSGPGERTENVPPDSFP
GDDSSYMDGPEDKVTFNVNLNSVFLRALHGDSEDTSELLSLTEDTIILDEVLPRSESGLV
MAAADRTQPPQPSLSSRDLWTEDGSSERTDTSSDSDADLGDGYIMR
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcttccgacccgcaccgcctccgccatctctttacttaacttgtgtcttgtggtgtac
ataagcctacagtttggtccatcatctgcttttgatgagtatccagaagaactttgcact
acaaacctggcatttcgaaatttccggctaattttatcgtgggaattaaaaaacaaatcc
atcccagcaactcactatacatttaattacacaatcatgagcaaaccagaagaagtgaag
gttgttaagaactgtacagatattaaggagtcatcgtgtgatgtgacagacgagtggagt
gacgtcactgagaactatgccgtcatcatcttggtgtacagaggggactccgtgacaagc
cagtgttcaggctctgtctcatacttagacgttcgtctggagcctccggaatttgagatt
gcgggctctacagatcacataaatgtggtggtgaaatttccacctgttactcccaagata
tttggggataacctatgggaaatgccaagttatagatcgtttgtcatcgaagaacagatg
gaggatggcattaacaagcacaaggtcaaaataaataatgttgttgggaacttcacctac
atccttagagacttgcttccgaagacaaactattgtgtatctgtttattttgaagtttca
ggacagaaagccacaataaagtctcccttaaaatgcaccctccttcagcctggccaggaa
tcaggctcatcagaatctgccactataggaataattactgggtgcttgatagtgacggtt
ttcataagcaccatcacaatactgaaacggattggttatatatgcttaaaaaacaatttc
cccaatgccttgaagttccgtcactttttagcatggatagtccctgaactgccaccgtca
gaagcagtgagcacattggagatcattccctccaacaagaagaagaaactgtggaattat
gattacggagatgaaagtgacagtgatgacgaagaagttcccaaagcaagggccactggg
tacaccatgcacggactgatggtcaagcttccgtcacaggcctctgactccccagaccag
cccccagaaccccagcctgaagaagattcagggactgaggaaacctacgaggctggggcg
ggggcgggagctgagctggagctgcccacagaggccgaggtggggccgggccttgggcct
tcagaagaccccagtggccccggtgagaggacagagaacgtgcctccagactcctttccc
ggggatgatagcagctacatggacgggcctgaagacaaagttaccttcaacgtgaactta
aactctgtgtttttgagagctctccacggcgactctgaagatacctcagagctgctctcg
ctcacagaagataccatcatcctagacgaggttctccccaggtcagagtcaggccttgtg
atggctgcggcggacaggacacagccgccccagcccagcctctcttcccgggacctatgg
acggaagacgggtcctctgaaagaactgacacttcttcggattccgatgctgacctagga
gatggctacattatgagataa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110541917
Entry
110541917         CDS       T05884                                 

Gene name
Ifnar1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110541917 (Ifnar1)
   04151 PI3K-Akt signaling pathway
    110541917 (Ifnar1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110541917 (Ifnar1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110541917 (Ifnar1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110541917 (Ifnar1)
   04621 NOD-like receptor signaling pathway
    110541917 (Ifnar1)
   04650 Natural killer cell mediated cytotoxicity
    110541917 (Ifnar1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110541917 (Ifnar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110541917 (Ifnar1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110541917 (Ifnar1)
   05160 Hepatitis C
    110541917 (Ifnar1)
   05171 Coronavirus disease - COVID-19
    110541917 (Ifnar1)
   05164 Influenza A
    110541917 (Ifnar1)
   05162 Measles
    110541917 (Ifnar1)
   05168 Herpes simplex virus 1 infection
    110541917 (Ifnar1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110541917 (Ifnar1)
   05169 Epstein-Barr virus infection
    110541917 (Ifnar1)
   05165 Human papillomavirus infection
    110541917 (Ifnar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110541917 (Ifnar1)
Cytokine receptors [BR:mun04050]
 Interleukin receptor families
  IFN receptor family
   110541917 (Ifnar1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 110541917
NCBI-ProteinID: XP_021484278
LinkDB
Position
Unknown
AA seq 548 aa
MLAVLGAAALVLLAQAPWVLPEAAGGENLRPPENIDVYIVDDNYTLKWNSSEELMGSVTF
SAEYQTEELENWLKLPECQHITRTECEFSLLDSDVYVNTKFHVRAEKGNSTSPWSESESF
IPFYRAHIGPPGVQLEAEDKAILVNISHPGQGGNMWARESFSFMYKIVIWQTSSDEKKII
ETTYYSEKILKLSPETTYCLEVEAVHSLLQKHSRSAVQCINTTVTSKMPTPENVELDARG
ESYVLKWDYNSSLNVSFRAQWLLGYLKSIPGSFSDQWRPIPTCANVQTTYCVFPQDTFHI
TTFFLRVQASHGNNTSFWSEEKYINSQKYTTIPPPVIGITPTSDSFRVYVTCQDSSISKC
HGLIYEIIFWENTSSTERRMEKENPTFTIVNLQPLTVYCVRARVHSFARWNKSSEFSDKL
CKKTKPGNSSLTWIIIGFGAVVFSVMALYAGKCLLKYLSSVFFPSLKPPPSIDEFLSEPP
SKTLLLLTAEEHTERCFIVENTDTVAVEESHLTEEDHRKYSSQTSQDSGNYSNEEESSGS
ESSRGLRP
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgctcgccgtcctgggcgcggcggccctggtgctgctggcccaggcgccgtgggtgctg
cccgaagccgcgggtggagaaaatctgagacctcctgagaatatagatgtctacattgta
gatgacaactacaccttaaagtggaacagcagcgaagagttgatgggcagcgtgaccttt
tcagcagagtatcagacagaagagttggagaactggttaaaactgcctgagtgtcaacat
attacgaggaccgaatgtgaattctctttactggactcagatgtttatgtcaacacaaag
tttcatgtaagagcagaaaaagggaacagcacttctccgtggagtgagagcgagtcattt
attccgttttacagagctcacattggccccccaggcgtccagttagaagccgaggataaa
gctatcctagtaaacatctctcatcctggacaaggtgggaacatgtgggcgagggagagt
ttcagcttcatgtacaagatagtaatctggcagacatcttcagatgagaaaaaaattatt
gaaactacttattactcagaaaagatactaaaactgtcaccggagactacttattgcttg
gaagtggaagcggtacactcgttgcttcagaaacacagcagaagcgccgtgcagtgtatc
aacaccacagtaacaagtaaaatgcctacgccagaaaatgtagagctggatgcccggggt
gagagctatgttctgaaatgggactacaactcatctctaaacgtgagcttcagagcgcag
tggctccttggctatctaaaaagtattcctggaagcttttcagatcaatggagaccaata
cctacctgtgcaaatgtccagactacgtactgtgtcttccctcaagatactttccacata
acaactttcttcctccgcgtacaagcatcacatggaaataacacatccttttggtctgaa
gagaaatatattaattctcaaaaatacactaccatccctcctccggtcattggcatcact
cccactagcgactcatttcgtgtctatgtcacatgtcaggacagttccatcagcaaatgt
catggactaatttatgaaatcattttttgggaaaatacttccagtactgagagaagaatg
gagaaagagaacccgacgtttaccatcgtgaacctgcagccactgactgtgtactgtgtc
cgagccagggtgcactcctttgccaggtggaataagagcagcgaattcagtgataaactg
tgtaagaaaacaaagccagggaattcttccttgacctggatcatcattggattcggcgct
gtggttttttccgtcatggccctttatgctgggaagtgcctcctgaaatacctcagtagt
gtgttcttcccttcgctgaagcctcctcccagtatcgatgagtttctctctgaaccacct
tcaaaaacccttctacttttgactgccgaggagcacacagaaagatgcttcatcgttgaa
aacacagatacggttgctgtagaagaaagccatctcaccgaggaagatcacagaaagtac
agttctcagaccagccaggactcggggaactattctaacgaagaggaaagttcgggcagt
gaaagcagcagagggctcaggccgtag

DBGET integrated database retrieval system