KEGG   Meriones unguiculatus (Mongolian gerbil): 110541906
Entry
110541906         CDS       T05884                                 

Gene name
Il10rb
Definition
(RefSeq) interleukin-10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04061  Viral protein interaction with cytokine and cytokine receptor
mun04630  JAK-STAT signaling pathway
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110541906 (Il10rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110541906 (Il10rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110541906 (Il10rb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110541906 (Il10rb)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110541906 (Il10rb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110541906 (Il10rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110541906 (Il10rb)
   04090 CD molecules [BR:mun04090]
    110541906 (Il10rb)
Cytokine receptors [BR:mun04050]
 Interleukin receptor families
  IL10/28 receptor family
   110541906 (Il10rb)
CD molecules [BR:mun04090]
 Proteins
  110541906 (Il10rb)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 zf-MIZ EBP Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 110541906
NCBI-ProteinID: XP_021484267
LinkDB
Position
Unknown
AA seq 351 aa
MARARGSASWLAGFLLLPALGMLPPPENVRMNSVNFKNILQWDPPAFPKENLTFTAQYES
YRYFQDRCKNTVSTQCDFSTLSKYGVHTLRVRTEFADECSDWVNITFCPVDDTTIGPPEM
HIEFLADSLHMRFSAPHIENEPETWTMKNIYISWAYRVQYWKNGTNEKVQVTSPYDFEVI
RGLEPWTTYCVQVQGFLQGQNRTGEWSKPVCERATSDEMTPSWMVAAVLITSVFVVVLFL
LGCFGLLWFIYKKAKYTFCSGTSLPQHLKEFLGHSHHSTLLLFSFPLTEEPEVFDKLSVV
TEATEGSKQTLADSCALGTLCEPGHQELESKDKSPEPALGDPLLLRSASEV
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccagggcgcggggctcggcgagctggctggccggcttcctgctgctgccagctcta
ggaatgctgccgcctcctgagaatgtcaggatgaactcagttaatttcaagaacatccta
caatgggatccacctgctttccccaaagagaacctgactttcacagctcagtatgaaagc
tacaggtatttccaagatcgctgcaagaacactgtctctacacagtgtgacttctccact
ctctctaagtatggtgtgcacactctgagagtcaggactgagttcgcggatgagtgttcg
gactgggtgaacatcaccttctgccctgtagatgacaccactattggacctcctgagatg
cacatagaatttcttgctgattctttacatatgcgcttctcagccccgcacattgagaat
gagcctgagacgtggaccatgaagaacatttacatctcatgggcttatagggtgcaatat
tggaaaaatgggactaatgagaaggttcaagtcacttctccatatgactttgaggtcatc
agaggcctggagccgtggacaacttactgcgttcaagttcaagggtttcttcaaggccag
aacagaaccggagaatggagcaaacctgtgtgtgagcgggcgaccagtgacgaaatgacc
ccttcctggatggtggccgctgtcctcataacctctgtctttgtggtcgtcctctttctc
cttggctgctttggcttgctgtggttcatttacaagaaggccaagtacaccttctgctct
gggacgtctcttccacagcacctgaaggagtttctgggccactcccatcacagcacgctt
ctgctcttctccttccctctcactgaggagcctgaagtgtttgacaaactgagtgtcgtc
acagaagccaccgaaggcagcaagcagactctcgcagacagctgtgccctggggaccctg
tgtgaaccaggacatcaggagctggagtccaaggataaaagccccgagcctgcgcttggt
gaccccttactgctcaggtcggcctcagaagtgtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110549113
Entry
110549113         CDS       T05884                                 

Gene name
Il10ra
Definition
(RefSeq) interleukin-10 receptor subunit alpha isoform X1
  KO
K05134  interleukin 10 receptor alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04061  Viral protein interaction with cytokine and cytokine receptor
mun04630  JAK-STAT signaling pathway
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110549113 (Il10ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110549113 (Il10ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110549113 (Il10ra)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110549113 (Il10ra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110549113 (Il10ra)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110549113 (Il10ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110549113 (Il10ra)
   04090 CD molecules [BR:mun04090]
    110549113 (Il10ra)
Cytokine receptors [BR:mun04050]
 Interleukin receptor families
  IL10/28 receptor family
   110549113 (Il10ra)
CD molecules [BR:mun04090]
 Proteins
  110549113 (Il10ra)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 110549113
NCBI-ProteinID: XP_021493627
LinkDB
Position
Unknown
AA seq 570 aa
MLSRLLPLLLVTFAVPSLSFRAHGTELPSPSSVWFEARFFQHILRWTAIPNQSEDTYYEV
ALKKYGTTVWKDIHSCREAGGLSCDVTAFTLDLYRDRYGYRARVRAVENSLYSNWTITET
RFTVDEVILTVDAMTLEVTNGCIFGTIHPPRPPITPAGDEYEQIFSNHRVYILSIRKVSE
QKNTTKRVTQENFTLQVPRGMREFCVKVKPHVESRDNKAEWSEEQCLRLTEQYFTATNLS
IFFTLVLLLCGALVFLALLCYIRRPGKLPAVLVFEEPHNFFLANPLFPETLDAIHILDLE
AFPKVSPELKDSELHGSTDSGFGSGKPSLQTEDSQFLLPGSHPQVQGTLGKEEPPELQDT
CGDNTDSGICLREPSSHSSMGPTWKQQFGYTHQGQDDSDINLVQNSPGQPTYAQDGSALD
HVCLPEPRVLEEKDQALVTFQGYQKQTRWMEETANPEEHLNKESPLTDAFDPKLAVCLQD
ELALVKGYVKQESQGKTAAPSVTTSRQWNQLTEEWSLLDTVSCEDLSIESWSFAHKLASL
DCGAATGGFLGNLDPTLATLPLISSLQVEE
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgctttcccgtttgctccccctcctcctcgtcacgttcgctgtcccgagcctgagcttc
cgcgcacacgggacagaactgcccagcccttcttctgtgtggtttgaagccagatttttc
cagcacatcctccgctggacagctatcccaaatcagtctgaggacacttactacgaagtg
gcgctcaagaagtacggaaccacggtctggaaagacatccacagctgtagagaggccggg
ggattgtcctgtgatgtcacagcattcaccctggatctataccgcgacagatacggctac
cgggccagagtccgggcagtggagaacagcctgtactccaactggaccatcactgagacc
cgcttcacagtggatgaagtgattctgacagtggatgccatgacattggaggtcaccaac
ggctgcatctttgggacaatccatccccccaggcccccaataacccccgcaggggacgag
tatgaacagatcttcagtaatcaccgtgtttatatactttccatccgaaaggtctcagaa
caaaagaatacaactaagagagtgacacaggaaaatttcaccctccaagtccccagaggg
atgagagagttttgtgtcaaggtgaagccccacgtggaatcacgagataacaaggcagaa
tggtcagaggagcagtgtttacgtctcacggagcagtatttcaccgcgaccaacctcagc
attttcttcactcttgtcttgctactgtgcggagccctggtcttcttggctctcctgtgt
tacatccggcgcccggggaagttgcctgcagtcctggtctttgaggagccgcacaacttc
ttcctggccaaccctctcttcccggaaactctcgatgccattcacatcctggacctggag
gccttcccgaaggtgtcaccagagctgaaagactcagagctgcatggcagcaccgacagc
ggctttggcagtggcaagccatcacttcagactgaagattcccagttcctcctccctggc
tcccacccccaggtgcagggaactctgggaaaagaggagcctccagagcttcaggacacc
tgtggggacaacacagacagtgggatctgcttgcgggaacccagctcacactccagcatg
gggcccacctggaagcagcagtttggatatacccatcagggccaggatgacagtgacatt
aacctagtccagaactctccagggcagcctacgtacgcacaggatggctctgccttggac
catgtctgtctcccagagcctagagtccttgaggagaaagaccaagctttggtgacattc
cagggctatcagaaacagaccagatggatggaagagacagccaacccagaagaacacttg
aacaaagagagtcccttgacagatgcctttgaccctaaacttgcagtgtgcctgcaggat
gagttagctctggtcaagggttatgtgaaacaagagtctcaggggaagactgctgctcca
tcagtgaccacaagtagacagtggaaccagctaactgaagagtggtcactcttggatact
gttagctgtgaagacctaagcatagagagttggagttttgcccataaacttgcctctctg
gactgtggggcagccactggtggcttcctgggtaaccttgaccctaccctggccacactg
ccattgatctccagcctgcaggtagaagaatga

DBGET integrated database retrieval system