KEGG   Meriones unguiculatus (Mongolian gerbil): 110542115
Entry
110542115         CDS       T05884                                 

Gene name
Xiap
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04064  NF-kappa B signaling pathway
mun04120  Ubiquitin mediated proteolysis
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04510  Focal adhesion
mun04621  NOD-like receptor signaling pathway
mun05145  Toxoplasmosis
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110542115 (Xiap)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110542115 (Xiap)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110542115 (Xiap)
   04215 Apoptosis - multiple species
    110542115 (Xiap)
   04217 Necroptosis
    110542115 (Xiap)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110542115 (Xiap)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110542115 (Xiap)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110542115 (Xiap)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110542115 (Xiap)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110542115 (Xiap)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110542115 (Xiap)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110542115 (Xiap)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110542115 (Xiap)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110542115 (Xiap)
   03029 Mitochondrial biogenesis [BR:mun03029]
    110542115 (Xiap)
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110542115 (Xiap)
Peptidases and inhibitors [BR:mun01002]
 Peptidase inhibitors
  Family I32: IAP family
   110542115 (Xiap)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110542115 (Xiap)
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    110542115 (Xiap)
SSDB
Motif
Pfam: BIR zf-C3HC
Other DBs
NCBI-GeneID: 110542115
NCBI-ProteinID: XP_021484438
LinkDB
Position
Unknown
AA seq 365 aa
MTFNGFEGSKTCVPADSNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHASVDRWQYGDSAVGRHRKISPNCRFINGFYFENSATQSTNPGIQNSQYTDENF
VGNRNHFALDRPSETHADYLLRTGQVVDMSDTIFPRNPDMCSEEARLKSFHNWPDYAHLT
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SGVSSERNFPNSTNSLRNPAMADYEARIVTFGTWIYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNVHLTNSLGESSVRTAEKTPS
LTKRI
NT seq 1096 nt   +upstreamnt  +downstreamnt
atgacttttaacggttttgaaggatctaaaacttgtgtgcctgcagactccaataaggat
gaagaatttgtagaagaatttaatagattaaaaacatttgctaactttccaagtagtagt
cctgtttcagcatcaacactggctcgagcagggttcctttatactggtgaaggagatacc
gtgcagtgctttagttgtcacgcatcagtagataggtggcaatatggagactcagctgtt
ggaagacacaggaagatatccccaaattgcagatttatcaatggcttttattttgaaaac
agtgctacacagtctacaaatcctggtatccaaaatagccagtacacggatgaaaatttt
gtgggaaacagaaatcattttgctcttgacaggccatctgagactcatgcagattatctt
ttgagaactggacaggttgtagatatgtcagacaccatattcccaaggaaccctgacatg
tgtagtgaagaagccagattgaagtcatttcacaactggccagactatgcccatttaacg
cccagagagttagctagtgctggactctactacacagggattgatgatcaagtgcaatgt
ttttgttgtggtggaaaactgaaaaattgggaaccctgtgatcgtgcctggtcagaacac
aggagacactttcccaattgcttctttgttttgggccggaatgttaatgttcgaagtgaa
tctggtgtgagttctgaaaggaatttcccaaattcgacaaattctctaagaaatccagcc
atggcagactatgaagcacggattgttacttttggaacatggatatactcagttaacaaa
gagcagcttgcaagagctggattttatgctttaggtgaaggtgacaaagtgaagtgcttt
cactgtggaggagggctcacagattggaagccaagtgaagacccttgggaacagcatgcg
aagtggtatccagggtgtaaatatctattggatgagaaggggcaagaatatataaataat
gttcatttaaccaattctcttggagaatcttcggtaagaactgctgaaaaaacaccatca
ctaactaaaagaatcg

KEGG   Meriones unguiculatus (Mongolian gerbil): 110553751
Entry
110553751         CDS       T05884                                 

Gene name
Birc3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04064  NF-kappa B signaling pathway
mun04120  Ubiquitin mediated proteolysis
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04390  Hippo signaling pathway
mun04510  Focal adhesion
mun04621  NOD-like receptor signaling pathway
mun04668  TNF signaling pathway
mun05132  Salmonella infection
mun05145  Toxoplasmosis
mun05168  Herpes simplex virus 1 infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110553751 (Birc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110553751 (Birc3)
   04064 NF-kappa B signaling pathway
    110553751 (Birc3)
   04668 TNF signaling pathway
    110553751 (Birc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110553751 (Birc3)
   04215 Apoptosis - multiple species
    110553751 (Birc3)
   04217 Necroptosis
    110553751 (Birc3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110553751 (Birc3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110553751 (Birc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110553751 (Birc3)
   05202 Transcriptional misregulation in cancer
    110553751 (Birc3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110553751 (Birc3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110553751 (Birc3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110553751 (Birc3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110553751 (Birc3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110553751 (Birc3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110553751 (Birc3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110553751 (Birc3)
Peptidases and inhibitors [BR:mun01002]
 Peptidase inhibitors
  Family I32: IAP family
   110553751 (Birc3)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110553751 (Birc3)
SSDB
Motif
Pfam: BIR CARD
Other DBs
NCBI-GeneID: 110553751
NCBI-ProteinID: XP_021501533
LinkDB
Position
Unknown
AA seq 605 aa
MNVVQDSVFLTRLMKSADSFELKYDFSCELYRLSTYSTFPAGVPVSERSLARAGFYYMGV
NDKVKCFCCGLMLDNWKQGDSPVAKHRQLYPSCSFVQTLNPASSLEASQQPPLPSAATST
VPSFFASLENTGYFSGSYSSFPSDPVNFRANQDCPALRASPCHFEMNTEKNRLLTYRTWP
LSFLSPAELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLKVLGK
SASRYTVSNLSMQTHPARIRTFCNWPSSALVPPQQLASAGFYYTGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLLEIKGQEFVSQVQANFPHLLEQLLSTSDTPPEDEKSEA
AIVHFGTGESSEDSVMMNTPVVKAALEMGFSRSLVRQTVQHQILATGENYKTISDLVIGL
LDAEDELREEQKEQAAEEKESEDLKLIRKNKMMLLQHLTCVTPILDCLLSAGAITEQECN
AVKQKPQTLQARTLIDTVLAKGNTAATSFRNSLQERDPVLYKDLFGELFRVNTSLGSTVM
LCPFLAQRNRTLGVFPQMTLQLYQWKNSCGNYRKKELAKCVWTERCPLSSSPVATWSYAK
TVPPP
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgaacgtggttcaagacagtgtcttcctgaccaggctgatgaagagcgctgactccttt
gagttgaagtacgacttctcatgtgagctgtaccgcctgtccacatactccactttcccc
gccggagttcctgtctcggaaaggagcctggctcgtgctggcttttactacatgggtgtg
aatgacaaggtcaagtgcttctgctgtggtctgatgctggacaactggaaacaaggggac
agtcctgttgcaaagcacagacagttgtatcccagctgcagctttgtgcagactctgaat
ccagccagcagtctggaagccagccagcagcctcccctcccctctgcagcgacaagcacc
gtgccttcattctttgcaagtctggagaacactggctatttcagtggctcttactcaagc
tttccctcagaccctgtgaacttcagagcaaatcaagattgtcctgctttgagggcaagt
ccctgccactttgaaatgaatacagagaagaacagattactcacctatcgaacatggcca
ttgtcctttctgtcacctgcagagctggccagagctggcttctactacatagggcctgga
gacagagtggcctgctttgcctgtggcgggaaactcagcaactgggaaccgaaggatgat
gctatgtcagagcaccggagacatttccccaactgtccattcttaaaagttctgggtaaa
tctgcttcaagatacactgtctctaacctgagcatgcagacacacccagcacgcattaga
acattctgtaactggccttctagtgcgctagttccacctcagcagcttgccagtgccggc
ttttattacacaggacacagtgatgatgtcaagtgcttttgctgtgatggtgggctgagg
tgctgggaatctggagatgacccctgggtggagcatgccaagtggtttccaaggtgtgag
tacttgctggaaatcaaaggacaagaatttgtcagtcaagttcaagccaatttccctcat
ctacttgaacagctattatctacgtcagacacccccccagaagatgaaaaatcagaagca
gcaatcgtgcattttggaactggtgaaagttcggaagattcagtcatgatgaacacgcct
gtggttaaagcagctttggaaatgggtttcagcagaagcctggtgagacagacagttcag
catcaaatcctggccactggtgagaactacaagaccatcagcgacctcgtgataggcttg
cttgatgcagaagatgagctaagggaagagcagaaggagcaggccgccgaggaaaaggag
tcagaggacctaaaattaatccggaagaacaagatgatgctcttacaacacttgacgtgt
gtgacaccaatcctggattgtctcctaagcgccggggccatcactgaacaggagtgcaat
gctgttaagcagaagccacagaccttgcaagcgagaacgctgattgatactgttttagcg
aaaggaaacactgcagcgacctcattcagaaactcccttcaggaaagggaccctgtgtta
tacaaagatttatttggagaactttttagagtgaataccagccttggttccacagtaatg
ctttgcccttttctcgcccagcgcaacaggacactaggagtcttcccacagatgacattg
cagctctaccaatggaagaacagttgcggaaactacaggaagaaagaacttgcaaagtgt
gtatggacagagaggtgtccattgtcttcatcccctgtggccacctggtcgtatgcaaag
actgtgccccctccctaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110553757
Entry
110553757         CDS       T05884                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 2 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04064  NF-kappa B signaling pathway
mun04120  Ubiquitin mediated proteolysis
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04390  Hippo signaling pathway
mun04510  Focal adhesion
mun04621  NOD-like receptor signaling pathway
mun04668  TNF signaling pathway
mun05132  Salmonella infection
mun05145  Toxoplasmosis
mun05168  Herpes simplex virus 1 infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110553757
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110553757
   04064 NF-kappa B signaling pathway
    110553757
   04668 TNF signaling pathway
    110553757
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110553757
   04215 Apoptosis - multiple species
    110553757
   04217 Necroptosis
    110553757
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110553757
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110553757
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110553757
   05202 Transcriptional misregulation in cancer
    110553757
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110553757
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110553757
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110553757
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110553757
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110553757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110553757
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110553757
Peptidases and inhibitors [BR:mun01002]
 Peptidase inhibitors
  Family I32: IAP family
   110553757
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110553757
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 110553757
NCBI-ProteinID: XP_021501549
LinkDB
Position
Unknown
AA seq 602 aa
MHKTISQSSLRYLTPKPNRIMEDSTILSNWTKESKEKMTYDFSCELYRMSTYSTFPPGVP
VSERSLARAGFYYMGVNDKVKCFCCGLMLDNWKQGDSPVEKHRQLYPSCSFVQTLLSARP
QPSSKNNSPVRSRPRDGLQSSLASDPLNSRAVEDFSSRMNPCSYAMSSEEARFLTYSMWP
LSFLSPAELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENFSE
TQRFSISNLSMQTHTARMRTFLYWPSSVPVQPEQLASAGFYYVDRNDDVKCFCCDGGLRC
WESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDTPGEESADPPI
VHFGPVESSEDAVMMNTPVVKAALEMGFSRSLVKQTVQHQILATGENYRTVNDIVSALLN
AEDERREEENERQTEEMASGDLSLIRKNRMALFQQLTCVLPILDNLLEASVITKQEHDII
RQKTQTPLQARELIDTVLVKGNAAANIFKNCLKEIDSTLYENLFVEKNMKYVPTEDVSGL
SLEEQLRRLQEERTCKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICRGTIKGTVRTF
LS
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgcacaaaactatctcccagagtagtctgaggtaccttacaccaaaacctaacagaata
atggaggatagcacaatcttgtcaaattggacaaaagaaagcaaagaaaaaatgacatat
gacttttcatgtgaactctacagaatgtccacatactccactttcccccccggagttcct
gtctcagaaaggagtctggcacgtgctggcttttactacatgggtgtcaatgacaaggtc
aagtgcttctgctgtggtctgatgctggacaactggaaacaaggggacagtcctgttgaa
aagcacagacagttgtatcccagctgcagctttgtgcagactctgctctcagctaggcca
cagccctcgtctaagaacaattctcctgtgagaagtaggccacgagatggccttcagtcc
agcctggcctcagaccctcttaattctagagcagtggaagacttctcatcaaggatgaac
ccttgcagctatgccatgagttctgaagaggccagatttcttacttacagtatgtggccg
ttaagctttctgtcacctgcagagctggccagagctggcttctactacatagggcctgga
gacagggtggcctgttttgcctgtggtgggaaacttagcaactgggaaccgaaggatgat
gctatgtcagagcaccggagacattttcccaactgtccatttctggaaaatttttcagaa
acacagaggtttagtatatcaaatttgagtatgcagacacacactgctcgaatgaggaca
tttctatactggccatctagtgttcctgttcagcctgagcagcttgcaagtgctggattt
tattatgtagatcgcaatgatgatgtcaaatgcttttgttgtgatggtggtttgaggtgc
tgggaatctggagatgacccctgggtagaacatgccaagtggtttccaaggtgtgagttc
ctgatacgaatgaaggggcaggagttcgttgatgagattcaagctagatatcctcatctt
cttgaacagctgttgtccacttcagacactccaggagaagaaagtgctgaccctccaatt
gtacattttggacctgttgaaagttcggaagatgcagtcatgatgaacacgcctgtggtt
aaagcagctttggaaatgggcttcagcagaagcctggtgaaacagacagttcagcatcaa
atcctggccactggtgagaactacaggaccgtaaatgatattgtctcagcacttcttaat
gctgaagatgaaagaagagaggaggagaacgaaagacaaactgaagaaatggcatcaggt
gacttgtcactaattcggaagaatagaatggccctctttcaacagttgacatgtgtcctt
cctatcctggataatcttcttgaggccagtgtaatcactaaacaggaacatgatattatc
agacagaaaacacagacacctttacaagcaagagagctgattgacactgttttagtcaag
gggaatgctgcagccaacatcttcaaaaactgcctgaaggaaattgactccacattgtat
gaaaacttatttgtggaaaagaatatgaagtatgttccaacggaagatgtttcaggcttg
tctttggaagaacagttgcggagattgcaagaagaacgaacttgcaaagtgtgtatggac
agagaggtttctattgtgttcattccttgtggtcatctggtggtctgccaggagtgtgcg
ccttccctgaggaagtgccccatctgcaggggtacgatcaagggcacagtgcgcacattt
ctctcataa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110554754
Entry
110554754         CDS       T05884                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 7-like
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04120  Ubiquitin mediated proteolysis
mun04215  Apoptosis - multiple species
mun05145  Toxoplasmosis
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110554754
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    110554754
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110554754
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110554754
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110554754
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110554754
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110554754
Peptidases and inhibitors [BR:mun01002]
 Peptidase inhibitors
  Family I32: IAP family
   110554754
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110554754
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-RING_2 zf-C3HC4 zf-RING_UBOX DUF2039 zf-C3HC4_2 ArfGap
Other DBs
NCBI-GeneID: 110554754
NCBI-ProteinID: XP_021503262
LinkDB
Position
Unknown
AA seq 279 aa
MFSPSDSLRVAVLSVGPKGRDRDLFCGPELSHREDSNGPTQEQGGPRCPRNHVLGQDCLD
GQILGQLRPGSEEEDSSEPAFPEMDSEDLRLASFYNWPSTAGIQPEPLAAAGFFHTGQQD
KVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLQSKGRDFVERIQTYAPLLGSWDQWE
EPEDAAPASPSAPALGGPELLTSRRETQPEEASEPGAGDVQEQLRQLQEERTCKVCLDRA
VSVVFVPCGHLVCTECAPNLQLCPICRVPICSCVRTFLS
NT seq 840 nt   +upstreamnt  +downstreamnt
atgttttctccttcagactcgctcagagttgctgtcctttctgtgggtcctaaaggtagg
gacagggacttgttctgtggcccagagctaagccacagggaagacagcaatggccccaca
caggagcagggtggaccccgctgtccccgtaaccatgtcctgggccaggactgcctggat
gggcagatcttgggccagttgcgcccagggtcagaagaagaagactcttctgagcctgcc
ttccctgagatggattcagaggatctccgcctagcttccttctacaactggccatccact
gcgggaatccagcctgagccattggctgctgcaggtttcttccacacaggccagcaggac
aaagtgagatgtttcttctgctatgggggtctacagagctgggagcgtggggatgatccc
tggacggagcatgcccgatggtttcccaggtgtcagtttctgctacagtcaaaaggaagg
gattttgtggaacgaatccagacatacgcccccttgcttggatcctgggaccaatgggaa
gaaccagaagatgcagcccctgccagcccctcagctcctgcccttggaggccctgagtta
ctcacatctagaagagagacccagcctgaagaagccagtgagccaggagctggggatgtg
caggaacagctgcgacagctgcaggaggagcggacgtgcaaggtgtgcctggatcgagcc
gtatctgtggtcttcgtgccctgcggccacttggtctgtactgaatgtgcccccaacctg
cagctgtgcccgatctgcagggtgcccatctgtagctgtgtacgcaccttcctgtcctaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110554792
Entry
110554792         CDS       T05884                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 7-like
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04120  Ubiquitin mediated proteolysis
mun04215  Apoptosis - multiple species
mun05145  Toxoplasmosis
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110554792
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    110554792
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110554792
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110554792
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110554792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110554792
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110554792
Peptidases and inhibitors [BR:mun01002]
 Peptidase inhibitors
  Family I32: IAP family
   110554792
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110554792
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-RING_2 zf-C3HC4 zf-RING_UBOX DUF2039 zf-C3HC4_2 ArfGap
Other DBs
NCBI-GeneID: 110554792
NCBI-ProteinID: XP_021503312
LinkDB
Position
Unknown
AA seq 279 aa
MFSPSDSLRVAVLSVGPKGRDRDLFCGPELSHREDSNGPTQEQGGPRCPRNHVLGQDCLD
GQILGQLRPGSEEEDSSEPAFPEMDSEDLRLASFYNWPSTAGIQPEPLAAAGFFHTGQQD
KVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLQSKGRDFVERIQTYAPLLGSWDQWE
EPEDAAPASPSAPALGGPELLTSRRETQPEEASEPGAGDVQEQLRQLQEERTCKVCLDRA
VSVVFVPCGHLVCTECAPNLQLCPICRVPICSCVRTFLS
NT seq 840 nt   +upstreamnt  +downstreamnt
atgttttctccttcagactcgctcagagttgctgtcctttctgtgggtcctaaaggtagg
gacagggacttgttctgtggcccagagctaagccacagggaagacagcaatggccccaca
caggagcagggtggaccccgctgtccccgtaaccatgtcctgggccaggactgcctggat
gggcagatcttgggccagttgcgcccagggtcagaagaagaagactcttctgagcctgcc
ttccctgagatggattcagaggatctccgcctagcttccttctacaactggccatccact
gcgggaatccagcctgagccattggctgctgcaggtttcttccacacaggccagcaggac
aaagtgagatgtttcttctgctatgggggtctacagagctgggagcgtggggatgatccc
tggacggagcatgcccgatggtttcccaggtgtcagtttctgctacagtcaaaaggaagg
gattttgtggaacgaatccagacatacgcccccttgcttggatcctgggaccaatgggaa
gaaccagaagatgcagcccctgccagcccctcagctcctgcccttggaggccctgagtta
ctcacatctagaagagagacccagcctgaagaagccagtgagccaggagctggggatgtg
caggaacagctgcgacagctgcaggaggagcggacgtgcaaggtgtgcctggatcgagcc
gtatctgtggtcttcgtgccctgcggccacttggtctgtactgaatgtgcccccaacctg
cagctgtgcccgatctgcagggtgcccatctgtagctgtgtacgcaccttcctgtcctaa

DBGET integrated database retrieval system