KEGG   Meriones unguiculatus (Mongolian gerbil): 110542356
Entry
110542356         CDS       T05884                                 

Gene name
Boc
Definition
(RefSeq) brother of CDO isoform X1
  KO
K20020  brother of CDO
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110542356 (Boc)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110542356 (Boc)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 ISET-FN3_linker V-set C2-set_2 Ig_4 Ig_5 C1-set Izumo-Ig Y_Y_Y
Other DBs
NCBI-GeneID: 110542356
NCBI-ProteinID: XP_021484625
LinkDB
Position
Unknown
AA seq 1110 aa
MTMCRGARPVVALVWLLLAAAGCLADPNAVPQVTVQPMSTVQKPGGTVILGCVVEPPRVN
VTWRFNGKELNGSNDALGVLITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPATVTLA
NLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRDNYLIMPSGNL
QIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPLEAQTVIVTKG
QSLILECVASGIPPPRVTWAKDGSSMAAYNKTRFLLSNLLIDTTSEEDSGTYRCMASNGV
GEPGVAVILYNVQVFEPPEVTVELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNAVPLTS
SQRLRLSRRALRVIGVGPEDEGVYQCMAENEVGSAHAVVQLRTARPDMTLRPGRNAKPVA
ATPPMPPSRPSRPSRPDQMLREQPGLAKPPTSVQPTSLKCLGEDQVAPAEAPIILSSPRT
SKTDSYELVWRPRHEGSSRPPILYYVVKHRKVTNSSDDWTISGIPASQHRLTLTRLDPGS
LYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIVASKEQQIQRDDPGASLQSSNQPDHSRL
SPPEAPDRPTISMASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIPPSR
LSVEITGLEKGISYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYITFTDA
VNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPE
TSYDIKMQCFNEGGESEFSNVMICETKARKISGQPGRPPPLTLAPPQPPPLESMERPVGT
GAMVARASDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLAFPRSALLSSSCQ
YTMVPLGGLPGHQANGQPYLINGRACVSRLHGSRGCPAAAVGCPGRKPQQHCPGELAQQR
EDTHSLLRQTIVSNGYDPQSQQVSRGPKSGSEEGSFLYTLPDDSSHQLLRPQDCCHVQKQ
PATTCQAAVRRAPEGPGLEASWDPPYHSGPRCCLGLAPVEEVDSSDSCQVGGGDRCAQHS
SGTYTGQELGMRLSPSPSVHVSFETPPPTI
NT seq 3333 nt   +upstreamnt  +downstreamnt
atgaccatgtgccgaggagcgcggcctgtggtcgcgctggtttggcttctcttagccgcg
gcaggctgccttgctgatccgaacgcagttcctcaggtcacggtccagcccatgtccact
gtccagaagcccggaggaaccgtgatcctgggctgtgtggtggagccgccacgggtgaac
gtaacctggcgcttcaacgggaaggagctcaatggctcgaatgatgcgctgggtgtcctc
atcacccgtgggacccttgtcatcgctgccctcaacaaccacactgtgggacggtaccag
tgtgtggctcggatgcctgcaggagctgtggccagtgtgccagccacggtgacgctagcc
aatctccaggactttaagttagatgtacagcatgtgatcgaagtagatgaggggaacaca
gctgtcattgcctgccacctgcctgagagccatcccaaagcccaggtccggtacagtgtc
aaacaggagtggctggaggcctctagagacaactacctgatcatgccgtcagggaatctc
cagatcgtcaacgccagccaggaggatgagggcatgtacaagtgtgccgcctacaaccca
gtgacccaggaagtgaaaacctctggctccagtgacaggctgcgtgtgcgccggtccact
gctgaggctgcccgcatcatctacccactggaagcccagactgtcattgtcaccaaaggc
cagagcctcatactagagtgcgtggccagtgggatcccgccacctcgagtcacgtgggcc
aaggatgggtccagcatggctgcctacaacaagacccgattcctgctgagcaacttgctg
atcgacaccaccagtgaggaggactcaggcacctaccgctgtatggccagcaacggggtt
ggggaacccggtgtggctgtcattctctacaatgtccaggtgtttgaaccccctgaggtc
actgtggagctgtcccagctggtcatcccgtggggccagagtgcaaagctcacctgtgag
gtgcgcggaaaccccccaccctctgttctgtggctgaggaacgccgtgcccctcacctcc
agccagcgcctgcggctgtctcggagagccctgcgtgtgatcggtgtcgggcctgaggac
gaaggcgtgtaccagtgcatggctgagaatgaagtggggagtgcccacgcggtggtccaa
ctgaggactgcacggccagacatgaccctgagacccgggaggaatgctaagccggtcgct
gccacacctcccatgccaccctccagacccagcagacccagcagacccgaccagatgctg
cgggagcaacctgggcttgctaagcccccaacatcagtacagccaacttccctgaagtgc
ctgggagaggaccaggtagcccctgcagaggcacccatcattctcagctccccccggacc
tccaagactgattcgtatgagctggtgtggcggcctcgacatgagggtagcagccggcca
cccatcctctactacgtggtgaaacatcgtaaggtcacaaactcctctgacgactggacc
atttccggcattccagccagccagcaccgcctcacccttaccaggcttgatcctggaagc
ttgtatgaagtggagatggcagcctacaactgtgccggcgagggccaaacggccatggtc
accttccgtacaggacggcggcccaaacccgagattgtggccagcaaggagcagcagatc
cagagagatgaccctggtgccagtctgcagagcagcaaccagcctgaccacagccgcctc
tcccccccagaagctccagacaggcccaccatctccatggcttctgagacctcagtgtac
gtgacgtggattccccgtggaaatggcggcttcccaattcagtctttccgtgtggagtat
aagaagctcaaaaaagtgggcgattggatcctggccactagtgccatccctccctcgagg
ctttctgtggagatcacaggcctggagaaaggtatttcttacaagttccgagtccgtgct
ttgaacatgctaggggagagcgagcctagtgccccctccaggccctacgtggtctcaggc
tacagcggccgtgtgtatgagaggcccgtggcaggcccgtacatcaccttcaccgatgcg
gtcaatgagaccaccatcatgctcaagtggatgtacattccagccagtaacaacaacacc
ccgatccatggcttctatatctactaccgacccacagacagtgacaatgacagtgattac
aagaaggacatggtggaaggggacaagtactggcactccatcagccacctgcagccagag
acctcctacgacattaagatgcaatgcttcaatgaaggaggggagagcgagttcagcaat
gtcatgatctgcgagaccaaagctcggaaaatttctggtcagcctggccggcccccgcct
ttaaccctggccccaccacagcctccaccgctagaaagcatggagcggccagtgggcact
ggagccatggtggcacgggccagcgacctgccgtatctgatcgtcggggtcgttttgggc
tctatcgtcctcatcattgtcaccttcatccccttctgcctatggagggcctggtccaag
cagaaacacacaacagatctggcttttcctcgaagtgccctcctgtcttcctcctgccag
tacacaatggtgccattgggaggacttccaggccaccaagccaatgggcagccctacctc
atcaatgggagggcctgtgtcagccgactgcatggaagcaggggctgcccggctgctgca
gtgggctgtccaggcaggaaacctcagcagcactgcccaggggaacttgcacagcagcgg
gaagacacccacagcctactgaggcagaccattgtcagcaacggatatgatccccagagc
cagcaagtttccagaggtcccaagtccggctcggaagaaggctctttcttatacacattg
cctgatgactcaagtcaccagctgctccgacctcaagattgctgtcacgtccagaagcaa
cctgccaccacatgccaggcagcagtgaggagggcacccgagggtcctgggctggaagct
tcgtgggaccctccgtatcactcagggccccggtgctgcttaggcctcgcgccagttgaa
gaagtagacagttccgactcctgccaagtgggtggaggagaccggtgtgcccagcactct
tcggggacctacacgggacaggaacttgggatgcgcctctctcctagcccgtcggttcac
gtgtcttttgaaacaccacctcccacaatttaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110547796
Entry
110547796         CDS       T05884                                 

Gene name
Lrp2
Definition
(RefSeq) low-density lipoprotein receptor-related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun04918  Thyroid hormone synthesis
mun04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110547796 (Lrp2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    110547796 (Lrp2)
  09154 Digestive system
   04979 Cholesterol metabolism
    110547796 (Lrp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110547796 (Lrp2)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    110547796 (Lrp2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 cEGF SGL EGF_CA hEGF
Other DBs
NCBI-GeneID: 110547796
NCBI-ProteinID: XP_021491276
LinkDB
Position
Unknown
AA seq 4661 aa
MERGAAAAAWMLLLAIIAACPAAVSGQDCGSGNFRCNNGYCIPAAWRCDGTKDCLDDTDE
IGCPPRSCGSGYFLCPTEGTCIPQAWVCDQDMDCSDGADEHQNCRGTTCSSQQLTCSDGQ
CVPMEYKCDRVSDCSDGSDERNCHYPTCDQLTCDNGACYNTSQKCDQRIDCRDSSDEANC
TAAMCSNKEFECGSGECILRAYVCDHDNDCQDNSDEHNCKYDTCGGHQFTCSNGQCISQN
WVCDGDDDCQDAGDEEGCESSQRYHSCYPREWACPGSGRCISIDSVCNGVPDCPGGEDEN
NATSGRQCGTDICSVLNCEYQCHQTPFGGECFCPPTHIINANDSRTCIDFDDCQIWGICD
QKCENQQGRHQCLCEEGYILERGQHCKSNDSFGAASIIFSNGRDLLVGNLHGSIFRVLVE
SRNRGVAMGVDFHYQKRRVFWTDPMQDKVFSTDINGLNTQEILNVSVDAPENVAVDWIND
KLYLVETKVNRIDVVNLDGSQRITLITENLGHPRGIALDPTVGYLFFSDWGSLSGEPKLE
RAFMDGSNRKDLVKTKVGWPAGITLDLVTKRVYWVDSRYDYIETVTYDGIQRKTVVHGGS
LIPHPFGISLFEEHVFFTDWTKLAVMKANKFTETHPQVYHQSSLRPNGVAVYHALRQPHA
SNPCGSNNGGCEQVCVLSHRTDNSGLGYRCKCEFGFELDTDERHCVAVKSFLLFSSKMAV
RGIPFTLSTQEDVMVPVTGGSSYFVGIDFDAQHSTIFFSDLSKDIIYKQKIDGTGKEVLT
ANRLQSVECLTFDWISRNLYWTDGGLKSVSVMKLADKSRRQIISNLNHPRSIVVHPAAGY
IFMSDWFRPAKIMRAWSDGSHLTTIVNTTLGWPNGLAIDWSASRLYWVDAFFDKIEHSTF
DGLDRKRLGRIDQMTHPFGLTIFKDNVFLTDWRLGAILRVRKSDGGDRTVIRSGISSIMH
VKTYDADLQTGSNYCSQPTHPNGDCSHFCFPVPNFQRVCGCPYGMRLQRDQMTCEGDPAR
EPPTPQCGSLSFACNNGKCVPSVFRCDGVDDCHDNSDELHCGAFNNSCSSSAFTCVRGGQ
CIPGQWRCDKQNDCLDGSDEENCPTSMISTCPSTSFTCDNYMCIPREWLCDTDNDCSDGS
DEKNCQASATCQPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGCVLNCTSSQFRCADGS
SCINVRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDRHPDCID
GSDEHNGCVPKTCASIYFLCDNGNCVYKSWICDGDNDCRDMSDEKDCPTQPFQCPSWQWQ
CPGYSTCINLSALCDGNFDCPNGTDESPLCNQDSCLHFNGGCTHQCVQGPFGATCICPPG
YQLANDTKTCEDINECELPGFCSQHCINMRGSFRCACDAEYLLESDGRTCKAAASESQLL
VVASQDKIIVDNITAHVHNIYSLVQDVSFVVALDFDSVTGRIFWSDIRQGKTWSVFQNGT
DKRVVHDSGLSVTEMIAVDWIGRNLYWTDYALETIEVSKIDGSHRTVLISKNVTKPRGLA
LDPRMGDNLMFWSDWGHHPRIERASMDGTMRTVIVQDKIYWPCGLSIDYPNRLIYFMDAY
LDYLEFCDYDGHNRRQVIASDLVLHHPYALTLFEDSVYWTDRGTWQVMQANKWHGGNQSV
VMYSVRQPLGIVAIHPSRQPSSPNPCASASCSHLCLLSAQPPRHYSCACPSGWNLSDDSV
NCVRGDQPFLLSVRDSIIFGISLDPEEKSNDAMIPIPGVHYGYDVEFDDSEQFIYWVENP
GEIHRVKTDGSNRTVFASLSLLGSSLGLAVDWVSRNIYYTTPGSRSIEVLTLQGDVRYGK
TLITDDGTPLGAGFPIGIAVDPARGKLYWSDQGTNGGVPAKIASANMDGTSLKILFTGNM
QHLEVVTLDIQEQKLYWAVTSTGVIERGNVDGTERTILVHHLAHPWGLAVHGSFLYYSDE
QYEVIERVDKSSGGNKVVLRDNIPKLRGLRVYHRRNAADSPNGCSNNPNACQQICLPVPG
GMFSCACASGFKLNPDGRSCSAYSSFIVVSLLPAIRGFSLVLSDHSEAMVPVTGQGRNVL
HTDVDVASGFIYWCDFSSSVSSSNGIRRIKPDGSNFTNIVTYGIGANGIRGVAVDWVAGN
LYFTNAFVYETLIEVVRINTTYRRVLLKVSVDMPRHIVVDPKNRYLFWADYGQRPKIERS
FLDCTNRTVLVSEGIVTPRGLAVDRNTGYIYWVDDSLDIIARVHLDGGESQVVRYGSRYP
TPYGITVFGESIIWVDRNLKKVFQASKEPGNTDRPTVIRDNINLLRDVTIFDEQAQPLSP
AELNNNPCLQSNGGCSHFCFALPDLPTPKCGCAFGALENDGKSCATSREDFLIYALNSSL
RSLHFDPADHSLPFQEINVEGTAVALDYDHRNNRIFFTQKLNSTHGQISHVSLYSGSTSP
AVLLSNIGITDGIAFDWINRRIYYSDFSNQTINSVAEDGSKRAVLARVSKPRAIVLDPCR
GYMYWTDWGTNAKIERATLGGNFRVPIVNTSLVWPNGLTLDLETDLLYWADASLQKIERC
ALTGTNREVVVSTAFHSFGLTVYGQYIYWTDVFTKKIYRANKYDGSDLIAMTTRLPVQPR
GISTVLKNQQQHCSNPCDQFNGGCSHICAPGPNGAECQCPHEGNWYLANDNKYCVADTGT
RCSQLQFTCLNGRCITEDWKCDNDNDCGDGSDELPTICAFHTCRSTAFTCANGRCVPYRY
RCDHYDDCGDNSDEAGCLFRNCNSTTEFSCSNGRCIPLSYVCNGINNCRDNDTSDERNCP
PRTCQPGFTKCQTTNICVLRAFLCDGDNDCGDMSDENPIYCASHTCRSNEFQCVSPQRCI
PDYWYCDGEADCSDSSDEPATCGPQVSTCSASEFQCDNGRCISSSWICDADNDCGDMSDE
DQRHHCELKNCSSSQFTCVNNRPPSRRCIPQSWICDGDADCEDALDELQNCPTRTCAAGE
FSCANGRCIMQSFRCDRRNDCGDYSDERGCSYPPCRADQFTCQNGRCISRLFVCDEDNDC
GDGSDEQEHLCNTPEPTCPPHQFRCDNGHCIDLGKVCNHVDDCSDNSDEKGCGINECQDP
SISHCDHNCTDTITSFYCSCLPGYKLMSDKRTCVDLDECKESPQLCSQRCENTVGSYICK
CAPGYIREPDGKSCRQNSNIEPYLIFGNRYYLRNLTTDGASYSLILQGLGNVVALDFDRV
EKRLYWIDAQKKIIERMFLNKTNRETIINHRLNGAESLAVDWVSRKLYWLDAFLDCLFVS
DLEGRHRRMLAQHCVDANNTFCFSNPRGIVLHPKNGHVYWADWGYQAFIGRVGMDGTNKS
VIISTKIEWPNAITIDYTNDLLYWADAHLGYIEFSDLEGRHRHTVYDGTLPHPYAMTIFE
DTVFWTDWNTRTVEKGHKYDGSDRVVLANTTHRPFDIHVYHPYRQPMVSNPCGTNNGGCS
HLCLIKAGGGGFTCACPDDFQTVHLRDRTLCMPMCSSTQFLCGNNEKCIPIWWKCDGQKD
CADGSDEPDLCPHRFCRLGQFQCRDGNCTSPQTLCNARQDCADGSDEEQALCEHHRCEAN
EWQCANKRCISEAWQCDSVDDCLDSSDEDSSHCASRTCKPGQFRCDNGRCIPQSWKCDVD
NDCGDYSDEPIHECMTAAYNCDNHTEFSCKTNYRCIPQWAVCDGFDDCRDNSDEQGCEAV
PCEPTGDFRCRNHQCIPLRWKCDGYNDCGDNSDEENCVPRECTESEFRCVNHQCIPSRWV
CDQENDCGDNSDERDCEMKTCSPEHFQCTSGHCVPKALACDGRADCLDASDESTCPTRFP
NGTYCPAALFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNIPCESPHRFRCDNSRCV
YGHQLCNGVDDCGDGTDEKEEHCIKPTHKPCTDTEYKCSNGNCISQHYVCDNVNDCGDLS
DETGCNLGENRTCAENLCEQNCTQLSDGGFICSCRPGFKPSTLDKNSCQDINECEQFGIC
PQRCRNSKGSYECFCADGFKSMSSHYGERCAADGSPPLLLLPENVRIRKYNVSSEKFSEY
LEEEEHIQTIDYDWDPEGLGLSVVYYTVLGQGSEFGAIKRAYIPDFESGSNNPIREVDLG
LKYIMQPDGLAVDWVGRHIYWSDAKNQRIELATLDGRYRKWLITTELDQPAAIVVNPKLG
LMFWTDQGRQPKIESAWMTGEHRSVLVSEDLGWPNGLSIDYLNDDRIYWSDSKEDVIETI
KYDGTDRRLIINEAMKPFSLDIFEDQLYWVAKEKGEVWRQNKFGKENKEKVLVVNPWLTQ
VRIFHQLRYNKSVPNPCKQVCSHLCLLRPGGYSCACPQGSSFLTGSTVQCDAASELPITM
PPPCRCMHGGTCYFDENDLPKCKCSSGYNGEYCEVGLSRGIPPGTTMAVLLTFLMVIIIG
ALVLVGFFHYRKTGSLLPTLPKLPSLSSLAKPSENGNGVTFRSGADVNMDIGVSPFGPET
VIDRSMAMNEHFVMEVGKQPVIFENPMYAAKDSTSKVTPAAQGLSVCSQVTVSENVENQN
YGSPVDPSEIAPEPKPASPRADESQGSKWSIFKRKPKQTTNFENPIYAEMDNEQKEGVAA
APPPSPSLPAKTSKRNTTPGYTATEDTFKDTANLVKEDSDV
NT seq 13986 nt   +upstreamnt  +downstreamnt
atggagcgcggggccgcggccgcggcgtggatgctgctgctggccatcatcgccgcctgc
ccggcggcggtcagcggccaagactgcggcagtgggaattttcgctgtaacaatggatac
tgcattcctgcagcctggaggtgtgatgggaccaaagactgtctggatgacacagatgaa
attggctgtcctccccgttcttgcggatcgggctatttcctgtgtccgactgaggggacc
tgcatcccccaggcttgggtgtgtgaccaggacatggactgttcggatggagcagatgaa
catcaaaattgccgtgggaccacatgctcaagccagcagctgacatgctccgacggtcag
tgtgttcccatggaatacaagtgtgaccgcgtcagcgactgttccgacggctcggacgag
aggaactgccattacccaacatgcgatcaactgacctgtgacaatggagcctgttacaac
acgagccagaagtgtgaccagcggattgattgcagggactcctctgatgaagccaactgc
acggccgccatgtgctcgaacaaagaatttgaatgtggcagtggagagtgtatccttcgc
gcctacgtctgtgaccacgacaacgactgtcaagataatagtgatgaacacaattgcaag
tatgacacctgcggaggccaccagttcacttgctccaatggccagtgcattagccagaac
tgggtgtgtgatggagacgatgactgccaggatgctggtgatgaagagggatgcgaaagt
agccaacgttatcattcatgttacccaagagaatgggcttgtccagggtctgggcgatgc
atctcaattgattcagtttgtaatggagttccagactgtccaggaggagaagatgaaaac
aacgccaccagcggaagacagtgtggcacggacatctgctctgtcttaaactgtgagtac
caatgccaccagaccccgtttggaggagaatgcttctgccccccaactcatatcatcaac
gccaatgatagccgtacttgcattgattttgatgactgccagatatggggaatttgtgac
cagaagtgtgaaaaccaacaaggccgtcaccagtgcctctgtgaggaaggctatatcttg
gagcgcgggcagcattgcaaatccaacgattccttcggtgcagcctccatcatcttctcc
aatggtcgggatttgctagttgggaatcttcacgggagcatcttccgggttctcgtggag
tctagaaaccgcggagtggctatgggcgtggatttccactatcagaagcgcagagtcttc
tggacagaccccatgcaagacaaggttttttccaccgacattaacggcttaaatacccaa
gaaattcttaacgtttctgtggatgctccagagaatgtggctgtggactggattaatgat
aagctttatctggtagagacaaaggtcaaccgcattgatgtggtcaacttggatggaagt
cagcgtattactctcataaccgaaaacttggggcatcctagaggaattgccctagaccca
actgtgggctatttgtttttctcagactggggaagcctctctggggagcccaagctggag
agagccttcatggacggcagcaatcggaaagacctggtcaagacgaaagtgggctggccc
gctggcatcactctggatctggtgaccaagcgagtgtactgggtggactctcgttatgac
tatatcgaaactgtgacatacgatgggattcaaaggaagacagtagttcacggaggctcc
cttatccctcatccctttggaataagcttgtttgaggaacatgtgttctttactgattgg
acgaagctggccgtgatgaaagcaaacaagttcacagaaacccaccctcaggtgtatcac
cagtcttccctgaggcctaatggggtggcagtttaccatgccctcaggcagccccatgcc
agcaatccgtgtggcagtaacaacgggggctgtgaacaggtctgtgtcctcagtcacagg
acggataacagtggcctgggctaccgctgcaagtgtgaatttggctttgaactggacact
gatgagcgccactgtgttgccgttaagagcttcttgctcttctcatcgaaaatggccgtg
cgtgggatcccattcacgctttctacccaggaagatgtcatggttcctgtcacaggaggt
tcttcctactttgttggaattgattttgatgcccaacacagcaccatcttcttctcagat
ttatcaaaagacataatttataaacaaaaaatcgatggcacaggaaaagaagtcctcaca
gcaaacaggttgcaaagtgtggagtgtctgacttttgactggatttcaaggaatctctac
tggacagatggagggctaaagagtgtcagcgtcatgaagctggctgataagtcccgacgg
cagataatcagcaacttaaaccacccccgctccattgtggtccaccctgctgctgggtat
atattcatgagtgactggttccgtcctgctaaaattatgagagcgtggagcgatgggtct
cacctaacgactatagtcaacactactctggggtggcccaatggcttggccatcgactgg
agtgcttcacgactgtactgggtagatgccttttttgataaaattgagcacagtaccttt
gacggtttagatagaaaaagattgggccgaatcgaccagatgacgcatccttttggactc
accatttttaaagataacgtgtttttgacagactggagactgggggcaatccttcgcgtc
aggaaatctgatggtggtgataggacagttatccggagtggcatcagcagcataatgcat
gtgaaaacctacgacgctgacctccagacggggtccaactactgcagtcagcccacccat
cccaacggcgactgcagccacttctgcttcccagtaccaaacttccagcgggtgtgtggc
tgcccctacggcatgaggcttcagagggatcagatgacgtgtgagggcgacccagcccgc
gagccgcccacgccgcagtgcggctccctctcgtttgcctgcaacaatggcaagtgtgtg
cccagtgtattccgctgcgacggagtggatgattgtcatgacaacagcgacgagcttcac
tgtggcgccttcaataattcctgttcgtcttcggctttcacctgtgtccgcggcgggcag
tgcatccctggccagtggcgctgtgacaaacagaatgactgtttagatggcagtgacgag
gaaaactgccccactagtatgatttcaacctgcccatccacctccttcacctgcgacaat
tacatgtgtatcccaagagaatggctctgtgacacagacaatgattgttcggatggatca
gatgaaaagaactgccaagcttcggcgacctgccaacctacacagttccgttgccctgac
caccgatgtatcagcccgttgtatgtctgcgatggggacaaggactgtgttgatgggtct
gatgaggcaggctgtgtgttaaactgcacgagttcgcagttcagatgcgctgatgggagt
tcttgcattaacgtcagataccgctgtgacggggtttatgactgcaaggacaactctgac
gaggcaggctgtccaaccaggcctcctggcatgtgccatccagacgagtttcagtgccaa
ggagatggtacctgcatccctaacacctgggagtgtgacagacacccagactgcatcgac
ggatctgatgagcacaacggctgtgtccctaagacctgcgcttcgatctattttctctgt
gacaatgggaattgcgtctacaaatcatggatctgtgacggggacaatgactgcagggat
atgagtgatgagaaggactgccccacccagccttttcagtgtcccagttggcagtggcag
tgccccggctacagcacctgtatcaacctgagtgccctctgcgatggcaactttgactgc
ccgaatgggactgatgagtccccactttgcaaccaggacagctgtttacattttaatggt
ggttgcacccaccagtgtgtccaggggccctttggagccacgtgcatatgtccgccaggg
taccaacttgccaacgatactaagacctgtgaagatataaacgagtgtgaacttccaggc
ttctgcagccagcactgtatcaacatgagaggctccttccggtgtgcttgtgatgcagaa
tacttactggaaagtgatgggcggacttgcaaagccgcagcatctgaaagtcagttgtta
gttgtagcaagtcaggacaaaatcatcgtagacaatatcactgcccatgtgcacaacatc
tattcattggtccaggatgtttctttcgtggttgctcttgattttgattcggtcaccggt
cgcatcttttggtctgacatacggcaggggaaaacctggagtgtttttcaaaatggaaca
gacaagagagtggtacatgacagtggtctctctgtgacggaaatgattgcagtagattgg
ataggtcgcaacctttactggacggactatgctcttgaaacaattgaagtttctaaaatt
gatggaagccacaggacagtgctaattagcaaaaatgtcacaaaacctaggggactagca
ttggatcccagaatgggtgacaatctaatgttctggtctgactggggccatcacccacgc
atcgagcgagccagcatggatggtaccatgcgcacagtcattgtccaggacaagatctac
tggccctgcggcctaagtattgactaccccaaccgactcatctacttcatggatgcctat
ctcgactaccttgaattctgtgattatgatggacacaatcgaaggcaggtcattgccagt
gatttggttctccaccacccatacgctctgactctgtttgaagactctgtgtactggact
gaccgtggcacttggcaggttatgcaggccaacaagtggcatgggggaaaccagtctgtt
gtcatgtacagcgttcgccagcctctcgggattgttgccatccatccttcaaggcaacca
tcttccccaaatccatgcgcctctgcctcctgcagccatctctgcctgctttctgcacag
ccgcctagacattactcttgtgcttgtccttcaggatggaacctctctgacgattctgtc
aactgtgtgagaggagaccagcctttcttgctctctgtgagggacagtatcatctttgga
atctcccttgatcccgaggagaagagcaacgacgccatgattcccataccaggggtgcat
tatggttatgatgttgagtttgatgactcagagcagttcatctattgggttgagaatccg
ggtgaaattcacagagtgaaaactgacggcagcaacaggacagtatttgcttctctgtct
ctgctggggtcttctttgggcctggccgtagactgggtatcaagaaacatttattatacc
actcctggaagcaggtccatcgaggtgttgacactccagggagatgtgaggtatggaaaa
acgctcattaccgatgatggcacccctcttggcgctggtttcccgattggcatagctgtt
gatcctgcacgtgggaaactgtattggtcagaccaagggacaaacggcggggttcctgcc
aagattgcgagtgcgaacatggacggaacatctttgaaaattctcttcactgggaacatg
cagcacctggaggtggtcaccttggacattcaggagcagaagctctactgggcagtcacc
agcacaggcgtgatcgaaagaggaaatgtggacggcacagagcggacgatcctggtccac
cacctcgcccacccgtggggtcttgcggtccacggctccttcctttactactctgatgag
cagtatgaggtcattgaaagagtcgacaagtcctccgggggcaacaaagtcgtcttgaga
gacaacatcccgaaactgaggggccttcgggtttaccaccgacgaaatgctgctgactcc
cccaatggctgtagcaacaacccaaatgcttgccaacagatctgcctgcccgtaccaggc
ggaatgttctcttgtgcctgtgccagtgggtttaagctcaaccccgatggtcgctcctgt
tctgcatatagctctttcatcgtcgtttccctgctgcctgcaatcagaggcttcagcttg
gtgttgtctgatcactccgaggccatggtgccagtgactggccaagggcgaaatgttctg
cacacggatgtggatgttgcctccggcttcatttactggtgtgactttagcagctccgtg
agctcctctaacggaattcgtagaatcaaacccgatggctctaatttcaccaacatcgtc
acctatggcataggagcgaatggaatccggggagtggcagtggattgggtagcaggaaat
ctttattttaccaatgcctttgtttatgagacactgatagaagtggtacggatcaatacc
acgtaccgacgtgttctcctcaaagtctcggtggatatgcctcggcatattgttgtggac
cccaagaacagatatctcttctgggccgactatgggcagagaccgaagatcgaacgctct
tttctcgactgtaccaaccggactgtactggtttctgaagggatcgtcacacctcggggc
ttggcagtggaccgcaacactggctatatttattgggtcgatgactccctagacataatc
gccagggttcatctcgatgggggagagtctcaagtggttcgttatggtagtcgttatcca
acgccttacggcatcactgtgtttggagagtctatcatatgggtggataggaatttgaaa
aaggtcttccaggctagcaaagaaccggggaacacagatcggccaacagtgataagggac
aatatcaacctcctacgtgatgtgaccatctttgatgagcaagcccagcccctctcacca
gcagagcttaacaacaacccttgtttgcaaagtaatggtgggtgttcccacttctgcttt
gctctacctgacctgcctacccccaaatgcgggtgtgcctttggggcactggaaaatgat
ggcaagagctgcgctacctcgagagaagatttcctcatctatgccttgaatagttccttg
agaagtttacacttcgaccctgcggaccatagcctgcctttccaagaaataaatgtggaa
ggaactgctgtcgccctggattatgaccacagaaacaatagaatcttcttcacccaaaag
ttaaactctacccatggccagatttcccatgtcagcctgtattcaggatccacctcccca
gctgtcctgctttcaaatatagggattactgatggcattgcctttgactggataaataga
agaatttattacagtgacttttcaaatcagacgataaattccgtggccgaagatggatct
aagcgagctgtgctagcccgtgtgtccaaaccgagagcgattgtgttagatccttgccga
gggtacatgtattggactgactggggcaccaatgccaaaatcgagagagccacactggga
ggaaacttccgggtacccattgtgaacaccagcctggtctggcccaatgggctcactttg
gacctcgagaccgaccttctctactgggcagatgctagcctgcagaaaatagagcgctgt
gctctcacgggcacgaaccgagaagtcgtggtcagcactgcctttcattcctttggcttg
actgtctacggccagtacatttactggacagacgtcttcaccaaaaaaatctaccgtgct
aacaagtacgacgggtcagacctcatcgcgatgaccactcgcttgcccgtccagcctagg
ggcatttccacggttctgaaaaaccagcagcagcactgtagcaatccttgtgatcagttt
aacggaggatgcagccacatctgtgcaccaggtccgaatggagctgagtgtcagtgtcca
catgagggtaactggtacctggccaatgataacaagtactgcgttgcggacacaggtacc
cggtgtagtcagctccagttcacctgcctcaacgggcgctgcatcacggaggactggaaa
tgtgacaatgacaatgactgcggtgatggcagtgatgagctccccaccatctgtgccttt
cacacgtgccggtcaaccgccttcacctgtgccaacgggcggtgtgtcccgtatcgctac
cgctgcgatcactatgacgactgtggcgacaacagcgacgaggcaggctgcctcttcagg
aactgcaacagcaccacggagttcagctgcagcaacgggcggtgcatacccctcagttac
gtctgcaacggcataaacaactgccgtgataacgacacctcggatgagagaaactgccct
ccccgcacctgccagcctggattcacaaaatgccagaccacaaatatttgtgttctccga
gctttcttgtgtgatggagacaatgactgtggagatatgagtgatgaaaaccccatttac
tgtgcctcacacacatgccgcagcaatgagttccagtgcgtttccccccagcgctgtatc
cccgactactggtactgtgacggtgaagccgactgctccgatagctctgacgaacctgcc
acttgtgggcctcaagtgagcacctgttcagctagcgagttccagtgtgacaatggcagg
tgcatctccagtagctggatctgtgacgctgataatgactgcggggacatgagtgatgag
gaccagcgacaccactgtgagctcaagaactgctccagctctcagtttacctgtgtaaat
aacagacctccgagcaggaggtgtattccacaaagctggatctgtgatggcgacgcggac
tgtgaagatgccctggacgagctgcagaactgccccacgaggacctgcgctgcaggagaa
ttcagctgtgcaaacggacggtgtatcatgcagtccttcaggtgtgaccggcgcaatgac
tgtggggactacagcgacgagaggggctgctcgtacccaccctgccgtgcggatcagttt
acctgtcagaacgggcgatgcatctccaggctgttcgtctgcgatgaggacaatgactgc
ggagacgggtcagatgagcaggagcatctgtgcaacaccccggagcccacgtgcccccct
caccagttccggtgtgacaacgggcactgcatcgacctggggaaagtctgtaaccacgtg
gatgactgctcggacaacagcgacgagaaaggctgtggcattaatgagtgccaggatccc
tccatcagtcactgcgaccacaactgcacagacaccatcaccagcttctactgttcctgt
ctccccgggtacaagctcatgtctgacaaacggacctgcgtagatctggacgaatgcaag
gagtcaccgcagctctgtagccagaggtgcgagaacaccgtgggctcctacatttgcaag
tgtgcccccggctacatccgagagccggatgggaagtcctgccggcagaacagcaacatc
gagccctacctcatcttcggcaaccggtactacctaaggaacctgactacagacggcgcg
tcctactccctgattttgcaaggactggggaatgtcgtggccctggactttgacagagtg
gagaagaggctgtactggatcgatgcacagaagaaaatcattgagaggatgtttctgaat
aagacaaaccgggagacgatcataaaccacaggctgaacggtgcggaaagtctggccgtg
gactgggtcagcagaaaactctattggttggatgccttcctggattgcctgtttgtctct
gaccttgaaggccgacaccgcagaatgctggctcagcactgtgtggatgccaacaatacc
ttttgcttttcaaatccccgggggattgtccttcatcctaaaaatgggcatgtctactgg
gcagattggggttatcaagcattcattgggagggttggcatggatggaaccaataagtct
gtgattatctccaccaagatcgaatggccgaatgccatcaccatcgactacaccaatgat
ctcttgtactgggcggatgctcacctgggctacattgaattctctgatttggagggtcgc
caccggcacacggtgtatgacggaacgctgcctcacccttacgctatgaccatttttgag
gacactgtgttttggacagactggaataccaggacggttgagaagggacacaagtatgat
gggtcagacagggtagtgttggcgaacacaacgcacaggccttttgacatccacgtgtac
catccgtacaggcagccgatggtgagcaatccctgtggtaccaacaatggtgggtgttct
cacctgtgcctcatcaaagcaggagggggaggattcacctgcgcatgcccggatgacttc
cagactgtgcatctgagagacaggacgctctgtatgccaatgtgctccagcacacagttc
ctgtgtggcaacaatgaaaagtgtatccccatatggtggaaatgtgatgggcagaaagac
tgcgctgatggttctgatgaaccagacctgtgcccacaccgcttctgccgcctgggacag
ttccagtgccgggatggaaactgcacaagcccccagactttgtgcaatgctcgccaggat
tgcgccgatgggtccgatgaagaacaggctctctgtgagcatcaccggtgtgaagccaac
gaatggcagtgtgcgaacaagcggtgcatctcggaggcctggcagtgcgactcagtggac
gactgcttggacagctcggatgaagacagctcccactgtgccagcaggacctgcaagccc
ggccagttccggtgtgacaacggtcgctgtatcccgcagagctggaagtgtgacgtagac
aatgactgcggagattactcggatgagcccatccatgaatgcatgactgctgcctacaac
tgcgacaaccacacggaattcagctgcaagaccaactaccgctgcatcccacagtgggcg
gtgtgcgacggctttgatgactgcagggacaacagtgatgagcaaggctgtgaagccgtg
ccgtgtgaacctacaggggacttccggtgtagaaatcaccagtgcatccctctccgctgg
aagtgtgatggctataacgactgtggagataactcagatgaggaaaactgtgtgcctcgg
gagtgcaccgagagcgagtttcgatgtgtcaatcatcaatgtatcccctctcggtgggtc
tgtgaccaagaaaatgactgtggagacaactcggacgaacgggattgcgagatgaagacc
tgcagtcctgaacattttcagtgtacgagtggacactgtgtgcccaaggcactggcgtgt
gatggccgagcagactgtctggatgcttcggatgaatccacttgtcctactcgctttccc
aatggtacctactgcccagctgccctgttcgagtgtaaaaaccatgtgtgtatccagtcg
ttttggatctgtgatggggaaaatgactgtgtcgacggttctgatgaggagattcacctg
tgcttcaacattccgtgtgaatcaccgcaccgtttccggtgtgacaacagtcgctgtgtt
tatggccaccagctgtgcaatggtgtggatgactgcggagatgggacggatgagaaggaa
gaacactgcataaaaccaacccataaaccctgcacggacactgaatataagtgtagcaac
ggaaactgcatttcgcagcactatgtgtgtgacaatgttaatgactgtggtgacctttct
gacgaaactggatgcaatctgggagagaacagaacatgcgctgagaacctatgtgaacag
aactgtacccagttaagcgatggaggatttatctgctcttgcagacctgggttcaaacct
agtactttggataaaaattcctgtcaagacatcaatgaatgtgagcagtttggcatctgc
ccccagagatgtcgaaacagcaaaggaagttatgaatgtttctgtgctgatggcttcaag
tctatgagttcccattacggagaacgctgtgcagctgatggaagccctccgctgttgctc
ctgcctgagaatgtccgaatccggaagtacaatgtctcctctgagaagttctcagagtat
ctggaagaggaggagcatatccagactattgactatgactgggatcccgagggcctgggc
ctcagtgttgtgtattacactgtgctgggacagggctctgaatttggtgctatcaagcgt
gcctacattcccgactttgaatctggtagcaataatcccatacgtgaagttgacctgggc
ctgaaatacataatgcagccggatggattagcagtggactgggttggaaggcatatttac
tggtcagatgccaagaaccaacggattgagttggcgacacttgatggaaggtaccgaaag
tggctcattaccaccgagctggatcagccagctgccattgttgtgaatcctaagctaggg
cttatgttctggactgaccagggaaggcagcctaaaatcgagtctgcctggatgaccggg
gaacatcgcagtgttctggtttctgaggaccttggctggccaaacggtctttccatagat
tatctgaatgatgaccggatctattggagtgactccaaagaagatgttattgaaaccata
aaatatgatgggactgacaggaggctcatcataaatgaagcaatgaagccgttcagtctg
gacatctttgaagaccagctctactgggtggctaaggaaaagggagaagtgtggagacaa
aataagtttgggaaagagaacaaggagaaagtgctggtggtgaacccatggctcactcaa
gttcgcatctttcatcaactgagatacaataagtcagtgcccaacccttgcaagcaggtc
tgcagccacctctgcctgctgaggccaggaggatacagctgtgcctgcccccagggctcc
agcttcttaactggcagcaccgttcagtgtgatgcagccagcgaacttcccatcaccatg
ccccccccatgcaggtgcatgcacggaggaacttgctattttgatgagaatgacctcccc
aaatgcaagtgttctagtggctacaacggagaatactgtgaggttgggctctcgagaggc
atccctccggggacgacaatggctgtgctcttgactttcctgatggtcatcatcattgga
gctctggtcctcgttggatttttccactacaggaaaactggctcccttttacccaccctg
cctaagctgccaagcttaagcagcctggccaaaccctctgaaaatggaaatggggtgact
ttcagatcgggggctgatgttaacatggacattggtgtgtctccttttggccccgagaca
gttattgacagatccatggcaatgaacgagcacttcgtcatggaggtgggcaagcagcct
gtgatctttgaaaaccccatgtacgcagccaaggacagtacttctaaagtgaccccggca
gctcagggcctgtcagtatgttcacaggtgactgtatcagaaaatgtggaaaaccagaac
tatggaagtcccgtggatccttctgagatagctccagagccaaagccagcctcccccaga
gctgatgaaagtcagggttcaaaatggagcatcttcaaacgaaaacccaaacagaccacg
aactttgaaaatccaatctatgccgagatggacaatgagcaaaaggaaggtgtggccgca
gccccccctccgtctccttccctccctgctaaaacttcaaaaagaaatacgactccaggc
tacacggccacagaagatacctttaaagacactgcaaatcttgttaaagaagattctgat
gtatag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110556602
Entry
110556602         CDS       T05884                                 

Gene name
Gas1
Definition
(RefSeq) growth arrest-specific protein 1
  KO
K06232  growth arrest-specific 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110556602 (Gas1)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 110556602
NCBI-ProteinID: XP_021506130
LinkDB
Position
Unknown
AA seq 385 aa
MDEDAHARSARNSDELFQRPRRRPRLDSAPHRVRRPLLPAMLAALLGGGGARTGTLPGAL
LCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPDCSYAYSQYAEACAPVLAQRGG
ADAPGPAGAFPASAASFSPRWRCPSHCISALIQLNHTRRGPALEDCDCAQDEHCRSTKRA
IEPCLPRTSGVGPGAGAGSVMGCTEARRRCDRDSRCNLALGRYLAYCGKLFNGLRCTDEC
RAVIEDMLAVPKAALLNDCVCDGLERPICESVKENMARLCFGPDAGNGPGSSGSDGGLDD
YYDEEYDDEQRAGAAGGEQPLDDDDGLARPGGGAAAADGRGDLPHGPGRRSSSSGSAGHW
ATRGAWTPFACLLLLLLLLLLGSHL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggatgaggacgcccatgccagaagtgcgcggaactcggatgaacttttccagcggccc
cgccgccgcccgcgcctcgactccgctccgcaccgcgtccggcggccgctgctgcccgcg
atgctagccgcgctgctgggcggcggcggggcccgcacggggaccttgccgggggccttg
ctgtgcctgatggcgctgctgcagctgctgggctcggcgccgcggggctcggggctagcg
cacggccgccgcctcatctgctggcaggcgctgctgcagtgtcagggagagcccgactgc
agctacgcctacagccagtacgccgaggcgtgtgcgcccgtgctggcgcagcgcggcggg
gctgacgctccggggcccgccggcgccttccccgcctcggccgcgtccttctcgccgcgc
tggcgctgcccgagccactgcatctcggcgctcatccagctcaaccacacgcgccgcggg
cccgcgctggaggactgcgactgcgcgcaggacgaacactgcagatccaccaagcgcgcc
atcgagccctgtctgccgcgcaccagcggcgtgggcccgggcgccggagcgggctcggtc
atgggctgcaccgaggcccggcggcgctgcgaccgcgacagccgctgcaatctggccctc
ggccgctacctggcctactgcggcaagctcttcaacgggctgcgctgcacggacgagtgc
cgcgcggtcatcgaggacatgctggccgtgcccaaggcggcgctgctcaacgactgcgtg
tgcgacgggctggagcggcccatctgcgagtcggtcaaggagaacatggcccgcctgtgc
ttcggcccagatgcgggcaacggtccgggcagcagcggctcggacggaggcctggacgat
tactacgacgaagaatacgacgacgagcagcgcgccggggcggcgggcggcgagcagccc
ctggacgacgacgacggcctggcgcgcccgggcggcggcgctgctgcggcggatggccgc
ggggacctgccgcacgggcccggccgcaggagcagcagcagcggcagtgcaggccactgg
gcgacccgaggcgcctggaccccgtttgcctgtttgctgctgctgctactgctgctactg
ctcgggtcacacttgtag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110560386
Entry
110560386         CDS       T05884                                 

Definition
(RefSeq) cell adhesion molecule-related/down-regulated by oncogenes
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110560386
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig V-set Ig_5 Ig_4 Ig_6 Pur_ac_phosph_N Tissue_fac Interfer-bind EphA2_TM
Other DBs
NCBI-GeneID: 110560386
NCBI-ProteinID: XP_021511934
LinkDB
Position
Unknown
AA seq 1256 aa
MHPDLGALWTLLYVLVILCPSVSSDLAPYFISEPLSAVQKLGRPVVLHCSAKPVTARISW
LHNGKRLDRNTEQIKIHRGTLTILSLNPSLSGCYQCVANNSVGAIVSGPAAVSTAALGDF
DSSTMPVITAEERNTGFIGCRVPESNPKAEVRYKIRGKWLNYSTGNYIILPSGNLQILNV
SSKDKGSYKCAAYNPVTSELKVEPTGRKLLVSRPSSDGFHILHPALSQELAVLPHSPVTL
ECVVSGVPASRVYWLKDGQDAVSGSNWRRLYSHLVTTSIDPVDSGNYSCVVGNKSGDIKH
ATYVVNVLEHASISKGLHDQKVSLGATVHFTCDVHGNPAPNRTWFHNAQPIHPSSRHLTE
GNGLKITGVTMEDSGLYQCIADNGIGFMQSTGRLQIEQDSGQKPVIVTTPANVEVMDGDF
VTLSCNATGVPVPVIHWYGRHGLITSHPSQVLRSKSRKSHLFRPGDLDLEPVYLIMSRAG
SSSLSIQSVTREHAGKYTCEATNKHGTSQSEVLLTVVPFETNTRAESVTPSEAAQNDERD
PRDDSESSLLNVFPVKVHASGMALPAENNASVPDAPNILSPPQTHMPDTYNLVWRAGRDG
GLPINAYFVKYRKLDDGTGTVGSWHTVRVPGSENELHLTELEPSSLYEVLMVARSAVGEG
QPAMLTFRTSKEKMASSKNTQASFPPVGSIPKRPVISEASNSNFGVVLTDSSRHSGVPEA
PDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRSSDWLVAAEDIPPSKLSVEVR
SLEPGSTYKFRVIAINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAYTEAVSDTQI
MLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHTIGHLQPETSYDIK
MQCFNEGGESEFSNVMICETKVKRVPGASEYPMKELSTPPSSSGNGGNVGPATSPARSSD
MLYLIVGCVLGVMVLILMVFIALCLWKSRQQNAVQKYDPPGYLYQGSEINRQMVEYTTLS
GTARINGSVHGGFISKGSLSNGCSHLHHKGPNGVNGILNGSINGGLYSAHTNSLTRTCVE
FEHPHHLVNGGGMYTAVPQIDPLECLNCRNCRNNNRCFTKTNSPLPVVPVVASYPQDGLE
MKPLSAMKVPVCPASTTPDCGQGPKESIKGSVAAAPTQHTCCQDNISDVSSDSTEDTAEF
NRGDSSAHSEAEEKVLSWNPLILSPVLEDCTEKTAWFPPGLPLDGLSSVLQQAQET
NT seq 3771 nt   +upstreamnt  +downstreamnt
atgcatccagacctcggagccttatggacactgctgtatgttcttgtgattctgtgtcct
tctgtgagttcagacttggcaccgtattttatctccgagccactctctgctgtccagaag
cttggtagacccgtggtcctacattgttctgctaaacctgtcactgcccgaatctcatgg
ttgcataatggaaaacgattggacagaaacacagaacagattaagattcatcgtgggact
ttgactattctgtctcttaacccttccctttctggctgctaccagtgcgttgccaataac
agtgtgggcgccattgtgagtggccctgcagcggtgtcaaccgcagctctgggtgatttc
gattcatcaactatgcctgttattactgcagaagagagaaacacgggtttcattggctgc
agggtaccagagagtaaccccaaagctgaggtgcgctataagatccgggggaagtggctg
aactattccacagggaactacataatccttccctcaggaaatcttcagattttgaatgta
tcctcaaaggataagggctcatacaaatgtgctgcttataatcctgtcacaagtgaactg
aaagttgaacccactggccggaagctccttgtgagtcgtccttcttcagatgggtttcac
attcttcaccctgctctctctcaggagttagctgtccttcctcacagccctgttaccttg
gagtgtgtggtgagtggggtcccagcctcacgagtgtactggctgaaggatggtcaggac
gctgtgtcaggaagcaactggagaaggctgtattctcatcttgtcacgactagcatcgac
ccagtggactctgggaactattcctgtgtggtgggcaacaagtccggagatataaaacac
gccacttacgtggttaatgtgctagagcatgcgtcaatttctaaaggactacatgatcag
aaggtgtctctgggagccaccgtacatttcacctgtgatgttcatgggaacccagctccc
aaccgtacgtggtttcataatgcacagcctattcacccctcctcacggcatctaaccgaa
gggaatggactgaagatcactggggttaccatggaagattctgggctgtatcagtgtata
gccgacaatgggattggatttatgcagtctactggaagacttcaaattgaacaagacagt
ggacagaagcctgttatagtcaccacaccagcaaatgtagaggtgatggacggagacttt
gtgactttgtcttgcaatgccacgggagtgcctgtccccgtcattcattggtacggccgc
catggattgataaccagccatccatcacaggtccttaggtctaagtcccgaaagtcccac
ctgttccgacctggggacctggacctggagcctgtctacctcatcatgtcccgagctggc
tcaagctctctgtctatccagtcagttactcgggagcatgctgggaaatacacctgtgaa
gctacaaacaaacacggcacctcacagtcggaagtgctcctcacagttgttccttttgaa
acaaatacaagagcagagtcagtcacaccttctgaagctgctcagaatgatgaacgagac
ccgagagatgattctgagtccagcttgctgaacgtgtttccagtgaaggtgcatgccagt
ggaatggcattgccagcagagaacaatgcctccgtccctgatgctcctaacatcctgagc
cccccacagacccacatgccagacacgtacaacctggtgtggagggcagggagggatggc
gggctgcccatcaatgcctattttgtgaagtaccgaaagctggatgatggtactggtaca
gtgggcagctggcacacggttcgtgtcccagggagtgaaaatgagctgcatctgactgag
ctggagccatcaagtctatatgaagttttaatggtggctagaagtgcagttggtgaagga
cagcctgccatgcttaccttccggaccagcaaagaaaaaatggcatcatcaaaaaacacc
caggcatcttttccacctgtgggcagcatccctaagcggcctgttatttcagaggcttcc
aacagcaattttggagttgtgcttacagattcctctaggcatagtggagtcccagaggca
ccagatcggcctactatctctacggcatcagagacctcagtctacgtaacttggattccc
cgggcaaatggtggttctccaatcactgccttcaaggtggaatataaacggatgaggagt
agtgattggctggtggctgctgaggatatccctccctccaaactttctgtggaagtacgc
agtttagaaccaggttcaacatacaaatttagggtcattgctatcaaccattatggagag
agttttcggagctcggcatcccgtccttatcaggtggctggcttcccaaatcgtttctcc
aaccgcccaataactggacctcatattgcctacacagaggctgtcagcgatactcagatc
atgctaaagtggacgtatattccatcaagtaacaataacactcccattcaaggattttat
atctattatcgaccaacagatagtgacaatgacagtgattataagagggatgttgttgaa
ggttcaaagcagtggcacacaattggtcacctgcagccagaaacctcttatgacattaag
atgcagtgctttaatgaaggtggggagagtgagttcagcaatgtgatgatctgcgagact
aaagtgaagcgtgttcctggagcttcagagtatcccatgaaggagctgagtacccctccc
agttcttcaggaaatggagggaacgtggggcctgcaaccagccctgccaggagcagtgat
atgttgtacctcatcgttggctgtgtgcttggtgttatggtcctcattcttatggttttc
attgcactgtgtttgtggaaaagtcgccaacagaatgccgtacagaaatatgatcctcca
ggatatctctaccaggggtctgagattaatagacagatggtagagtacaccacactctca
ggaacggcccggatcaatgggagtgttcatggaggcttcatcagcaaaggcagcctcagc
aatggctgttctcatctccaccataaaggccccaatggagtcaacgggatcctgaatgga
agcataaatggagggctttactctgcacacacaaactcgctaaccaggacgtgtgtggag
tttgagcatcctcaccatctagtgaatggaggaggaatgtacacagcagtccctcagatt
gaccccttggaatgccttaactgtcggaattgccggaacaacaacaggtgtttcaccaaa
accaacagtccccttcctgtggtcccagtggtagcctcctatcctcaggatggcctggaa
atgaagcccctcagtgccatgaaggtgcctgtgtgtccagcttccacaactcctgattgt
ggccagggacccaaggagagcatcaagggcagtgtggcagcagcacctacccagcataca
tgctgtcaggacaacataagtgacgtcagttctgattccacagaagacacagcggagttc
aacagaggagatagcagtgcgcattcagaagcagaggaaaaagttttaagttggaatccc
cttattttgtcacctgtcttggaggactgcactgagaagacagcgtggtttcctcctggc
cttcctctggatgggttgtcatcagtccttcagcaagcccaagagacctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110560391
Entry
110560391         CDS       T05884                                 

Gene name
Cdon
Definition
(RefSeq) cell adhesion molecule-related/down-regulated by oncogenes
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110560391 (Cdon)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig V-set Ig_5 Ig_4 Ig_6 Pur_ac_phosph_N Tissue_fac Interfer-bind EphA2_TM
Other DBs
NCBI-GeneID: 110560391
NCBI-ProteinID: XP_021511946
LinkDB
Position
Unknown
AA seq 1256 aa
MHPDLGALWTLLYVLVILCPSVSSDLAPYFISEPLSAVQKLGRPVVLHCSAKPVTARISW
LHNGKRLDRNTEQIKIHRGTLTILSLNPSLSGCYQCVANNSVGAIVSGPAAVSTAALGDF
DSSTMPVITAEERNTGFIGCRVPESNPKAEVRYKIRGKWLNYSTGNYIILPSGNLQILNV
SSKDKGSYKCAAYNPVTSELKVEPTGRKLLVSRPSSDGFHILHPALSQELAVLPHSPVTL
ECVVSGVPASRVYWLKDGQDAVSGSNWRRLYSHLVTTSIDPVDSGNYSCVVGNKSGDIKH
ATYVVNVLEHASISKGLHDQKVSLGATVHFTCDVHGNPAPNRTWFHNAQPIHPSSRHLTE
GNGLKITGVTMEDSGLYQCIADNGIGFMQSTGRLQIEQDSGQKPVIVTTPANVEVMDGDF
VTLSCNATGVPVPVIHWYGRHGLITSHPSQVLRSKSRKSHLFRPGDLDLEPVYLIMSRAG
SSSLSIQSVTREHAGKYTCEATNKHGTSQSEVLLTVVPFETNTRAESVTPSEAAQNDERD
PRDDSESSLLNVFPVKVHASGMALPAENNASVPDAPNILSPPQTHMPDTYNLVWRAGRDG
GLPINAYFVKYRKLDDGTGTVGSWHTVRVPGSENELHLTELEPSSLYEVLMVARSAVGEG
QPAMLTFRTSKEKMASSKNTQASFPPVGSIPKRPVISEASNSNFGVVLTDSSRHSGVPEA
PDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRSSDWLVAAEDIPPSKLSVEVR
SLEPGSTYKFRVIAINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAYTEAVSDTQI
MLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHTIGHLQPETSYDIK
MQCFNEGGESEFSNVMICETKVKRVPGASEYPMKELSTPPSSSGNGGNVGPATSPARSSD
MLYLIVGCVLGVMVLILMVFIALCLWKSRQQNAVQKYDPPGYLYQGSEINRQMVEYTTLS
GTARINGSVHGGFISKGSLSNGCSHLHHKGPNGVNGILNGSINGGLYSAHTNSLTRTCVE
FEHPHHLVNGGGMYTAVPQIDPLECLNCRNCRNNNRCFTKTNSPLPVVPVVASYPQDGLE
MKPLSAMKVPVCPASTTPDCGQGPKESIKGSVAAAPTQHTCCQDNISDVSSDSTEDTAEF
NRGDSSAHSEAEEKVLSWNPLILSPVLEDCTEKTAWFPPGLPLDGLSSVLQQAQET
NT seq 3771 nt   +upstreamnt  +downstreamnt
atgcatccagacctcggagccttatggacactgctgtatgttcttgtgattctgtgtcct
tctgtgagttcagacttggcaccgtattttatctccgagccactctctgctgtccagaag
cttggtagacccgtggtcctacattgttctgctaaacctgtcactgcccgaatctcatgg
ttgcataatggaaaacgattggacagaaacacagaacagattaagattcatcgtgggact
ttgactattctgtctcttaacccttccctttctggctgctaccagtgcgttgccaataac
agtgtgggcgccattgtgagtggccctgcagcggtgtcaaccgcagctctgggtgatttc
gattcatcaactatgcctgttattactgcagaagagagaaacacgggtttcattggctgc
agggtaccagagagtaaccccaaagctgaggtgcgctataagatccgggggaagtggctg
aactattccacagggaactacataatccttccctcaggaaatcttcagattttgaatgta
tcctcaaaggataagggctcatacaaatgtgctgcttataatcctgtcacaagtgaactg
aaagttgaacccactggccggaagctccttgtgagtcgtccttcttcagatgggtttcac
attcttcaccctgctctctctcaggagttagctgtccttcctcacagccctgttaccttg
gagtgtgtggtgagtggggtcccagcctcacgagtgtactggctgaaggatggtcaggac
gctgtgtcaggaagcaactggagaaggctgtattctcatcttgtcacgactagcatcgac
ccagtggactctgggaactattcctgtgtggtgggcaacaagtccggagatataaaacac
gccacttacgtggttaatgtgctagagcatgcgtcaatttctaaaggactacatgatcag
aaggtgtctctgggagccaccgtacatttcacctgtgatgttcatgggaacccagctccc
aaccgtacgtggtttcataatgcacagcctattcacccctcctcacggcatctaaccgaa
gggaatggactgaagatcactggggttaccatggaagattctgggctgtatcagtgtata
gccgacaatgggattggatttatgcagtctactggaagacttcaaattgaacaagacagt
ggacagaagcctgttatagtcaccacaccagcaaatgtagaggtgatggacggagacttt
gtgactttgtcttgcaatgccacgggagtgcctgtccccgtcattcattggtacggccgc
catggattgataaccagccatccatcacaggtccttaggtctaagtcccgaaagtcccac
ctgttccgacctggggacctggacctggagcctgtctacctcatcatgtcccgagctggc
tcaagctctctgtctatccagtcagttactcgggagcatgctgggaaatacacctgtgaa
gctacaaacaaacacggcacctcacagtcggaagtgctcctcacagttgttccttttgaa
acaaatacaagagcagagtcagtcacaccttctgaagctgctcagaatgatgaacgagac
ccgagagatgattctgagtccagcttgctgaacgtgtttccagtgaaggtgcatgccagt
ggaatggcattgccagcagagaacaatgcctccgtccctgatgctcctaacatcctgagc
cccccacagacccacatgccagacacgtacaacctggtgtggagggcagggagggatggc
gggctgcccatcaatgcctattttgtgaagtaccgaaagctggatgatggtactggtaca
gtgggcagctggcacacggttcgtgtcccagggagtgaaaatgagctgcatctgactgag
ctggagccatcaagtctatatgaagttttaatggtggctagaagtgcagttggtgaagga
cagcctgccatgcttaccttccggaccagcaaagaaaaaatggcatcatcaaaaaacacc
caggcatcttttccacctgtgggcagcatccctaagcggcctgttatttcagaggcttcc
aacagcaattttggagttgtgcttacagattcctctaggcatagtggagtcccagaggca
ccagatcggcctactatctctacggcatcagagacctcagtctacgtaacttggattccc
cgggcaaatggtggttctccaatcactgccttcaaggtggaatataaacggatgaggagt
agtgattggctggtggctgctgaggatatccctccctccaaactttctgtggaagtacgc
agtttagaaccaggttcaacatacaaatttagggtcattgctatcaaccattatggagag
agttttcggagctcggcatcccgtccttatcaggtggctggcttcccaaatcgtttctcc
aaccgcccaataactggacctcatattgcctacacagaggctgtcagcgatactcagatc
atgctaaagtggacgtatattccatcaagtaacaataacactcccattcaaggattttat
atctattatcgaccaacagatagtgacaatgacagtgattataagagggatgttgttgaa
ggttcaaagcagtggcacacaattggtcacctgcagccagaaacctcttatgacattaag
atgcagtgctttaatgaaggtggggagagtgagttcagcaatgtgatgatctgcgagact
aaagtgaagcgtgttcctggagcttcagagtatcccatgaaggagctgagtacccctccc
agttcttcaggaaatggagggaacgtggggcctgcaaccagccctgccaggagcagtgat
atgttgtacctcatcgttggctgtgtgcttggtgttatggtcctcattcttatggttttc
attgcactgtgtttgtggaaaagtcgccaacagaatgccgtacagaaatatgatcctcca
ggatatctctaccaggggtctgagattaatagacagatggtagagtacaccacactctca
ggaacggcccggatcaatgggagtgttcatggaggcttcatcagcaaaggcagcctcagc
aatggctgttctcatctccaccataaaggccccaatggagtcaacgggatcctgaatgga
agcataaatggagggctttactctgcacacacaaactcgctaaccaggacgtgtgtggag
tttgagcatcctcaccatctagtgaatggaggaggaatgtacacagcagtccctcagatt
gaccccttggaatgccttaactgtcggaattgccggaacaacaacaggtgtttcaccaaa
accaacagtccccttcctgtggtcccagtggtagcctcctatcctcaggatggcctggaa
atgaagcccctcagtgccatgaaggtgcctgtgtgtccagcttccacaactcctgattgt
ggccagggacccaaggagagcatcaagggcagtgtggcagcagcacctacccagcataca
tgctgtcaggacaacataagtgacgtcagttctgattccacagaagacacagcggagttc
aacagaggagatagcagtgcgcattcagaagcagaggaaaaagttttaagttggaatccc
cttattttgtcacctgtcttggaggactgcactgagaagacagcgtggtttcctcctggc
cttcctctggatgggttgtcatcagtccttcagcaagcccaagagacctga

DBGET integrated database retrieval system