KEGG   Meriones unguiculatus (Mongolian gerbil): 110542965
Entry
110542965         CDS       T05884                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110542965
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110542965
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110542965
   04612 Antigen processing and presentation
    110542965
   04658 Th1 and Th2 cell differentiation
    110542965
   04659 Th17 cell differentiation
    110542965
   04672 Intestinal immune network for IgA production
    110542965
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110542965
   05322 Systemic lupus erythematosus
    110542965
   05323 Rheumatoid arthritis
    110542965
   05320 Autoimmune thyroid disease
    110542965
   05321 Inflammatory bowel disease
    110542965
   05330 Allograft rejection
    110542965
   05332 Graft-versus-host disease
    110542965
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110542965
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110542965
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110542965
   05152 Tuberculosis
    110542965
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110542965
   05164 Influenza A
    110542965
   05168 Herpes simplex virus 1 infection
    110542965
   05169 Epstein-Barr virus infection
    110542965
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110542965
   05140 Leishmaniasis
    110542965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110542965
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110542965
  Exosomal proteins of epithelial cells
   110542965
  Exosomal proteins of breast milk
   110542965
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 DUF202 ig MHC_I C2-set_2
Other DBs
NCBI-GeneID: 110542965
NCBI-ProteinID: XP_021485113
LinkDB
Position
Unknown
AA seq 271 aa
MGAGRAPWVVALLVSLVRPDSFMAEGRDTPEDFVIQAKADCYFTNGTERVRFVVRFIFNL
EEYLHFDSDLGVFVALTQLGEPDAEQWNRRPDLLARSRASVNLVCRQNYRLGAPFTVGRN
VPPEVTVYPERTPLLWQHNLLLCLVTGFYPGHISVRWFRNGQEERSGVSSPGLVRNGDWT
FQTTVMLEVSPELGDTYSCQVEHPSLPSPVSVAWTAQPEYSWKKILSGGAAFLLGLIVFL
VGAVSHLKARKASERTQSGREVSGALLPPHP
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggtgctgggagggccccctgggtggtggctctgctcgtgagcctcgtgaggccagat
tccttcatggctgaaggcagagacaccccagaggattttgtgatccaggcgaaggcggac
tgttacttcaccaacggcacagagagggtgcgcttcgtggtcaggttcattttcaacctg
gaggagtatttacacttcgacagcgacctgggggtgttcgtggcgctgacgcagctgggg
gagcctgacgccgagcagtggaacagacgcccggatctcctggcgaggagcagagcctct
gtgaacctggtctgcaggcagaactacaggctgggggcccccttcaccgtggggaggaac
gtgcccccggaggtgacagtgtaccctgagaggactccgttgctgtggcagcacaacctg
ctgctctgcctggtgacaggcttctaccccgggcacataagtgtcaggtggttccggaac
ggacaggaggagcggtctggggtctcgtccccgggccttgtgaggaacggggactggacc
ttccagacgacggtaatgctggaagtgagcccggagcttggggacacctacagctgccag
gtggagcaccccagcctcccgagccccgtctccgtggcgtggacggctcagcctgagtat
tcgtggaaaaagatactgagtgggggcgcggcgttcctgcttgggctaatcgtcttcctg
gtgggcgctgttagccacctcaaggcccggaaagcgtctgagcggactcagtctggccgt
gaggtctcaggagctcttctcccacctcacccctag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543034
Entry
110543034         CDS       T05884                                 

Definition
(RefSeq) H-2 class II histocompatibility antigen, E-U alpha chain-like
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110543034
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543034
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543034
   04612 Antigen processing and presentation
    110543034
   04658 Th1 and Th2 cell differentiation
    110543034
   04659 Th17 cell differentiation
    110543034
   04672 Intestinal immune network for IgA production
    110543034
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110543034
   05322 Systemic lupus erythematosus
    110543034
   05323 Rheumatoid arthritis
    110543034
   05320 Autoimmune thyroid disease
    110543034
   05321 Inflammatory bowel disease
    110543034
   05330 Allograft rejection
    110543034
   05332 Graft-versus-host disease
    110543034
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110543034
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110543034
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110543034
   05152 Tuberculosis
    110543034
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110543034
   05164 Influenza A
    110543034
   05168 Herpes simplex virus 1 infection
    110543034
   05169 Epstein-Barr virus infection
    110543034
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110543034
   05140 Leishmaniasis
    110543034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543034
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110543034
  Exosomal proteins of epithelial cells
   110543034
  Exosomal proteins of breast milk
   110543034
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 110543034
NCBI-ProteinID: XP_021485160
LinkDB
Position
Unknown
AA seq 256 aa
MATVGDLVLRCLFMAVLMSSQESWAIKEKHTIIQAEFYLSPDMKGEFMFDFDGDEIFHVD
IEKSQTIWRLEEFGQFASFEAQGALANIAVDKANLEIMMKRSNNTPDANVPPEVSVLPRD
PVNLGEPNVLICFVDKFSPPAVNVTWLRNGQPVTTGVSETVFLPREDHLFRKFFYLPFLP
STEDFFDCQVDHWGLDEPLLKHWEFEEQTLLPETKENVLCALGLFVGLVGIVAGVVLAIK
GRQKRKATERRHQGGL
NT seq 771 nt   +upstreamnt  +downstreamnt
atggccacagttggggacctggtgctaagatgtctcttcatggctgtcctgatgagctcc
caggagtcatgggcaatcaaagagaagcacaccatcatccaggcggagttctacctttcc
ccggacatgaaaggagagttcatgtttgactttgacggtgacgagattttccacgtggat
atcgagaagtcacagaccatctggagacttgaagaatttgggcagttcgccagctttgag
gctcagggtgccctggccaacatagctgtggacaaagctaacctggagatcatgatgaag
cgctccaacaacactcccgatgccaatgtgccccctgaggtgagcgtgctgcccagagac
ccggtgaacctgggggagcccaacgtcctcatctgcttcgtcgacaagttctcccctccg
gccgtcaacgtcacctggcttcgcaacggacagcccgtcaccacaggcgtgtcagagacc
gtgttcctcccgcgggaggaccacctcttccgcaaattcttctatctgcccttcctgccc
tccacggaggatttctttgactgtcaggtggaccactggggtctggacgaacctctgctc
aagcactgggagttcgaagagcaaaccctcctcccagaaactaaggagaatgtgttgtgt
gctctcgggctgttcgtgggtctggtgggcatcgtggccggcgttgtgctcgccatcaag
gggaggcagaagcgcaaggccacagagcgccgccaccaaggaggcctgtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543060
Entry
110543060         CDS       T05884                                 

Definition
(RefSeq) class II histocompatibility antigen, M alpha chain
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110543060
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543060
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543060
   04612 Antigen processing and presentation
    110543060
   04658 Th1 and Th2 cell differentiation
    110543060
   04659 Th17 cell differentiation
    110543060
   04672 Intestinal immune network for IgA production
    110543060
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110543060
   05322 Systemic lupus erythematosus
    110543060
   05323 Rheumatoid arthritis
    110543060
   05320 Autoimmune thyroid disease
    110543060
   05321 Inflammatory bowel disease
    110543060
   05330 Allograft rejection
    110543060
   05332 Graft-versus-host disease
    110543060
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110543060
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110543060
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110543060
   05152 Tuberculosis
    110543060
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110543060
   05164 Influenza A
    110543060
   05168 Herpes simplex virus 1 infection
    110543060
   05169 Epstein-Barr virus infection
    110543060
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110543060
   05140 Leishmaniasis
    110543060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543060
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110543060
  Exosomal proteins of epithelial cells
   110543060
  Exosomal proteins of breast milk
   110543060
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_2
Other DBs
NCBI-GeneID: 110543060
NCBI-ProteinID: XP_021485183
LinkDB
Position
Unknown
AA seq 261 aa
MDREQRPGARLLRLLQLLWLLPRCWAVPDAPTPVRGDGPRNHTFRHTVFCQDREPRVGLS
ESYDEDQLFSYDFQQSSRVPRLPDFAQWAQEQGDAAAISFDKDFCQFLVREVSPQAEGQI
PVSRGLPIAEVFTLKPLEYGKPNTLVCFISNLFPPTLTVTWEHQSAPVEGASPTTISAID
GLTFQAFSYLNFTPEPFDLYTCIVTHEIDRYTAIAFWVPQNALPSDLLENVLCGMAFGLG
VLGIIVGTAFFVHAWRPCSGG
NT seq 786 nt   +upstreamnt  +downstreamnt
atggaccgcgagcagaggccgggggcccggctgctgaggctgctgcagctgctgtggctg
ctgccccgctgctgggcggtgcccgacgcgccgaccccggtgcggggggacggccctcgg
aaccacacgttccggcacactgtcttctgccaggaccgggagcccagggtcgggctgtct
gagagctacgatgaagaccagctgttctcctacgacttccagcagagcagcagggtgccc
cggctgcctgactttgcccagtgggctcaggagcagggagatgctgccgccatttcattt
gacaaagacttctgccagtttctggtccgggaagtgagcccacaggctgaagggcaaatc
ccggtgtccagaggcttgccgatagctgaggtgttcacactgaagcccctggagtacggc
aagcccaacacgctggtctgcttcatcagcaacctcttcccacccaccctgacggtgacc
tgggagcaccagtccgcccccgtggagggagccagccccacgaccatctcggccatcgac
ggactcaccttccaggccttctcttacttaaacttcacaccggagccctttgacctttac
acttgcatcgtgacccatgagattgatcgttacacagcaatcgccttttgggtgccccag
aatgccctgccttcggatctcctagagaatgttctgtgtggtatggccttcggcctaggt
gtcctgggcatcatcgtgggcactgccttcttcgtccacgcctggagaccttgctcaggt
ggctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543088
Entry
110543088         CDS       T05884                                 

Definition
(RefSeq) class II histocompatibility antigen, M beta 1 chain
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110543088
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543088
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543088
   04612 Antigen processing and presentation
    110543088
   04658 Th1 and Th2 cell differentiation
    110543088
   04659 Th17 cell differentiation
    110543088
   04672 Intestinal immune network for IgA production
    110543088
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110543088
   05322 Systemic lupus erythematosus
    110543088
   05323 Rheumatoid arthritis
    110543088
   05320 Autoimmune thyroid disease
    110543088
   05321 Inflammatory bowel disease
    110543088
   05330 Allograft rejection
    110543088
   05332 Graft-versus-host disease
    110543088
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110543088
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110543088
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110543088
   05152 Tuberculosis
    110543088
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110543088
   05164 Influenza A
    110543088
   05168 Herpes simplex virus 1 infection
    110543088
   05169 Epstein-Barr virus infection
    110543088
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110543088
   05140 Leishmaniasis
    110543088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543088
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110543088
  Exosomal proteins of epithelial cells
   110543088
  Exosomal proteins of breast milk
   110543088
SSDB
Motif
Pfam: C1-set MHC_II_beta Ig_2 Ig_3
Other DBs
NCBI-GeneID: 110543088
NCBI-ProteinID: XP_021485205
LinkDB
Position
Unknown
AA seq 259 aa
MAALLLLLSLSLGCVGVGGFVAHVESTCLLDDDGVPKDFTYCVSFNKDLLACWDPEEGHV
APCEFGTLANLAMFISQYLNKDDSLIQRLHNGLQDCGTHTQPFWDALTHRTRPPSVQVAP
ATPFNTREPVMLACYVWGFYPADVTIVWMKNGQLVSPHGGSKTAQPNGDWTYQAVSYLAL
TPSYGDVYTCVVQHAGTPKPVREDWMVGLSPIQTVKVSVSAATLGLGVIVFCLGLFSWRK
SRSSSYIPLPGSTYPEGWH
NT seq 780 nt   +upstreamnt  +downstreamnt
atggccgcactcctgctgctgctcagcctcagcctgggctgtgtgggcgtaggtggcttt
gtggctcacgtggaaagcacctgcctgctggatgatgacggggttccgaaggacttcacc
tactgcgtctccttcaacaaagacctgctggcctgctgggatccggaggaaggacacgta
gccccctgcgaattcgggacgctggctaacttggccatgttcatttcacagtacctcaac
aaagacgacagcctgatccagcgcttgcacaatggcctccaggactgtgggacgcacacc
cagcccttctgggatgcgctgacccacagaacgcgaccgccatctgtccaagtagcccca
gccactccctttaacacgagggagcctgtgatgctggcctgctacgtctggggcttctat
ccggcggacgtgaccatcgtctggatgaagaatgggcagctagtctctcctcacggcggc
agcaagacggcccagcccaacggagactggacataccaggccgtctcctacctagccctc
accccctcctatggggatgtctacacctgtgtggtgcagcatgccgggacccccaagccc
gtccgtgaggactggatggtcgggctgtcccccatccagacggtgaaggtctctgtgtct
gcagccacccttggcctgggcgtcatcgtcttctgtcttggtttgttcagctggcggaag
tctcgctcctccagctacattcctctcccaggatccacgtacccggaaggatggcactag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543117
Entry
110543117         CDS       T05884                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: H-2 class II histocompatibility antigen, E-D beta chain-like
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110543117
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543117
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543117
   04612 Antigen processing and presentation
    110543117
   04658 Th1 and Th2 cell differentiation
    110543117
   04659 Th17 cell differentiation
    110543117
   04672 Intestinal immune network for IgA production
    110543117
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110543117
   05322 Systemic lupus erythematosus
    110543117
   05323 Rheumatoid arthritis
    110543117
   05320 Autoimmune thyroid disease
    110543117
   05321 Inflammatory bowel disease
    110543117
   05330 Allograft rejection
    110543117
   05332 Graft-versus-host disease
    110543117
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110543117
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110543117
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110543117
   05152 Tuberculosis
    110543117
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110543117
   05164 Influenza A
    110543117
   05168 Herpes simplex virus 1 infection
    110543117
   05169 Epstein-Barr virus infection
    110543117
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110543117
   05140 Leishmaniasis
    110543117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543117
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110543117
  Exosomal proteins of epithelial cells
   110543117
  Exosomal proteins of breast milk
   110543117
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 DUF5529 ig Tricorn_C1 DUF202 DUF3040
Other DBs
NCBI-GeneID: 110543117
NCBI-ProteinID: XP_021485224
LinkDB
Position
Unknown
AA seq 303 aa
MVCLWCSRGPCVAAVIAALVALSPPVALVRDPRPHFLLQLKAECHYFSGREHVWSATRFI
YNQEEFARFDSNLGKFLAVTELGAPIAEDLNSQKDVLDNYRASVDRCRNNYDLVDIFLLK
LKVEPKVSVHPAKTQRLEHHNLLICSVNDFYPGDLEVRWFRNGQEEKAGVSSTGLIPNGD
WTYQALVMLETVPQSGEVYACRVEHPSLSSPVTVEWRAQSTSAQSKMLTGVLVLVLGLFF
LVMGLFVYLRNLRGSCTHGAGGGAESSAXRSAGSSPERHTGPGLSCRSRRPCGASSFTTP
TLI
NT seq 912 nt   +upstreamnt  +downstreamnt
atggtgtgtctgtggtgctccagaggtccctgtgtggcagctgtgatcgcggcgctggtg
gcgctgagccctcccgtggctttggtccgggacccccgaccacattttctgttgcagctg
aaggccgagtgccattacttcagtgggagggagcatgtgtggagcgcgaccaggttcatc
tataaccaggaagagtttgcccgcttcgacagtaaccttgggaagttcctggcagtgact
gagctgggggcgcccatcgccgaggacctgaatagccagaaggacgtcctggacaattat
cgggcctcagtggacaggtgcagaaacaactacgaccttgttgatatcttcctgctgaag
ctaaaagttgagcccaaggtgtctgtgcaccctgcaaagacgcagcgcctggagcaccac
aacctcctgatctgctctgtgaatgacttctacccgggcgaccttgaggtcagatggttc
cggaacggccaggaggagaaggctggggtctcgtccacgggcctgatccccaatggagac
tggacctaccaggccctggtgatgctggagacggtcccccagagcggagaggtctacgcc
tgccgggtggagcatcccagcctgagcagccctgtcaccgtggagtggagggctcagtca
acttctgcacagagcaagatgctgaccggggtcctggtcctggtgcttggtctgttcttc
ctcgtgatggggctgtttgtctacctcaggaatctgagaggctcctgcacgcatggtgcg
ggaggaggagctgagagttctgcantcagatcagcaggcagcagccctgaacgccacact
gggcctggcttgagctgccgctcccggaggccctgtggggcatcttctttcaccacaccg
acccttatctaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543181
Entry
110543181         CDS       T05884                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain isoform X1
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110543181
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543181
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543181
   04612 Antigen processing and presentation
    110543181
   04658 Th1 and Th2 cell differentiation
    110543181
   04659 Th17 cell differentiation
    110543181
   04672 Intestinal immune network for IgA production
    110543181
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110543181
   05322 Systemic lupus erythematosus
    110543181
   05323 Rheumatoid arthritis
    110543181
   05320 Autoimmune thyroid disease
    110543181
   05321 Inflammatory bowel disease
    110543181
   05330 Allograft rejection
    110543181
   05332 Graft-versus-host disease
    110543181
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110543181
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110543181
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110543181
   05152 Tuberculosis
    110543181
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110543181
   05164 Influenza A
    110543181
   05168 Herpes simplex virus 1 infection
    110543181
   05169 Epstein-Barr virus infection
    110543181
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110543181
   05140 Leishmaniasis
    110543181
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543181
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110543181
  Exosomal proteins of epithelial cells
   110543181
  Exosomal proteins of breast milk
   110543181
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 110543181
NCBI-ProteinID: XP_021485262
LinkDB
Position
Unknown
AA seq 244 aa
MAHFVELVLAALTLMIFLCPLGVWAIEADHMGSYGPAFYQSYDASGQFTHEFDGEQIFSV
DLKNREVAWRLPEFADFPRSDFQSGLASIAMLGAHLDILVERSNRSRAVSVPPRVTVLPK
SPVELGKPNVLICIVADIFPPVIKITWLRNSQPVTKGVAQTSFYAQPNHRFRKFHYLTFV
PLAEDVYDCRVEHWGLDAPLLQHWEPQVPTPPPDTVETLICGLGLALGFVGFLLGITLII
TGNF
NT seq 735 nt   +upstreamnt  +downstreamnt
atggcccactttgtggagctggtcctggcagccctcaccctgatgatcttcctgtgtccc
ctgggagtatgggccatcgaggccgaccacatgggctcctacgggccagccttctaccag
tcttacgacgcttctgggcagttcacacacgaattcgacggggaacaaatcttctctgtg
gatctgaagaacagggaggtggcgtggcgtctgcccgagtttgccgacttcccgcgctcc
gactttcagagcgggctggccagcattgccatgctcggagcccacctggacatcctggtg
gagcgctccaaccgaagcagagccgtgagcgtgccgcccagggtgaccgtactccccaag
tctcccgtggagctgggaaagcccaacgttctcatctgcatcgtggctgacatcttcccc
cctgtgatcaaaatcacctggctgcgcaacagccagcccgtcactaagggcgtggcccag
accagcttctacgcccagcctaaccacaggttccggaagttccactacctgaccttcgtg
cccttggcagaggacgtgtatgactgcagggtggagcactggggcctggacgctccgctc
ctccagcactgggagccccaggtgccgactccgccgccggacaccgtagagaccctgatc
tgtggcctgggcctggctctcggctttgtgggcttcctcctgggcatcacgcttatcatc
acaggtaacttctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543223
Entry
110543223         CDS       T05884                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: H-2 class II histocompatibility antigen, I-E beta chain-like
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110543223
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543223
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543223
   04612 Antigen processing and presentation
    110543223
   04658 Th1 and Th2 cell differentiation
    110543223
   04659 Th17 cell differentiation
    110543223
   04672 Intestinal immune network for IgA production
    110543223
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110543223
   05322 Systemic lupus erythematosus
    110543223
   05323 Rheumatoid arthritis
    110543223
   05320 Autoimmune thyroid disease
    110543223
   05321 Inflammatory bowel disease
    110543223
   05330 Allograft rejection
    110543223
   05332 Graft-versus-host disease
    110543223
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110543223
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110543223
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110543223
   05152 Tuberculosis
    110543223
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110543223
   05164 Influenza A
    110543223
   05168 Herpes simplex virus 1 infection
    110543223
   05169 Epstein-Barr virus infection
    110543223
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110543223
   05140 Leishmaniasis
    110543223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543223
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110543223
  Exosomal proteins of epithelial cells
   110543223
  Exosomal proteins of breast milk
   110543223
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig
Other DBs
NCBI-GeneID: 110543223
NCBI-ProteinID: XP_021485293
LinkDB
Position
Unknown
AA seq 265 aa
MVRLWLPRGPCVAAAVLTLVALSPPVALVRDPRPRFLEQAKGECHFLNGTERVRFLHRHF
YNREELVRXSDVGEHRAVTELGRPDAKYWNSQKDILERLRAAVDTYCRHNYGVVESFTVQ
RRVEPKVSVHPAKTQRLEHHNLLICSVNDFYPGDLEVRWFRNGXEEKAGVSSTGLIPNED
WTYQALVMLETVPQSGEVYACRVEHPSLSSPVTVEWRAQSTSAQNKMLSGVGGFVLGLLF
LGGGLFIYLRNQKGQSGLQPTGLLS
NT seq 798 nt   +upstreamnt  +downstreamnt
atggtgcgactgtggctccccagaggtccctgtgtggcagctgcggtcctgacgctggtg
gcgctgagccctcctgtggctttggtccgggacccccgacctcggttcttggaacaagct
aaaggtgagtgtcatttcctcaacgggacggagcgagtgcggtttctgcacagacacttc
tacaaccgggaggagctcgtgcgcnngagcgacgtgggcgagcaccgcgcggtgaccgag
ctggggcggccggatgccaagtactggaacagccagaaggacatcctggagcgtctgcgg
gccgcggtggacacgtactgcagacacaactacggggtcgtggagagcttcactgtgcag
cggagagttgagcccaaggtgtctgtgcaccctgcgaagacgcagcgcctggagcaccac
aacctcctgatctgctctgtgaatgacttctacccgggcgaccttgaggtcagatggttc
cggaacggcnaggaggagaaggctggggtctcgtccacgggcctgatccccaatgaagac
tggacctaccaggccctggtgatgctggagacggtcccccagagcggagaggtctacgcc
tgccgggtggagcatcccagcctgagcagccctgtcaccgtggagtggagggcgcagtcc
acatctgcacagaacaagatgctgagcggagtcgggggcttcgtgctgggcctgctcttc
ctcggaggcgggctgttcatctacctcaggaaccagaaaggacagtctggacttcagccc
acaggactcctgagctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543234
Entry
110543234         CDS       T05884                                 

Definition
(RefSeq) rano class II histocompatibility antigen, B-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110543234
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543234
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543234
   04612 Antigen processing and presentation
    110543234
   04658 Th1 and Th2 cell differentiation
    110543234
   04659 Th17 cell differentiation
    110543234
   04672 Intestinal immune network for IgA production
    110543234
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110543234
   05322 Systemic lupus erythematosus
    110543234
   05323 Rheumatoid arthritis
    110543234
   05320 Autoimmune thyroid disease
    110543234
   05321 Inflammatory bowel disease
    110543234
   05330 Allograft rejection
    110543234
   05332 Graft-versus-host disease
    110543234
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110543234
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110543234
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110543234
   05152 Tuberculosis
    110543234
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110543234
   05164 Influenza A
    110543234
   05168 Herpes simplex virus 1 infection
    110543234
   05169 Epstein-Barr virus infection
    110543234
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110543234
   05140 Leishmaniasis
    110543234
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543234
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110543234
  Exosomal proteins of epithelial cells
   110543234
  Exosomal proteins of breast milk
   110543234
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig Ig_2 Marek_A MHC_I I-set
Other DBs
NCBI-GeneID: 110543234
NCBI-ProteinID: XP_021485299
LinkDB
Position
Unknown
AA seq 263 aa
MALQVPSLLAAAVVVLTALSSPGAEGRDTPRDSLFQFKGQCYYTNGTQRIRSVVRYIYNR
EEFMRFDSDVGEYRAVTELGRPDAKYWNSQKDILEGTRAEVDTVCRHNYEGLEVSSLRRL
EQPKVAISLSRTEALNHHNLLVCSVTDFYPAQVKVRWFRNGQEETSGVVSTKLIKNGDWT
YQVLVMLEMTPQRGDAYTCHVEHPSLQSPVTVEWRAQSESAQGKMLSGIGGFVLGLIFLG
LGLFFRHRSQKGARGPPPAGLLQ
NT seq 792 nt   +upstreamnt  +downstreamnt
atggctctgcaggtccccagcctcctagccgccgctgtggtggtgctgaccgcgctgagc
agtccaggcgccgagggcagagacaccccgagggactccctgttccagttcaagggccag
tgctactacaccaacgggacgcagcgcattcggagtgtggtcagatacatctacaaccgg
gaggagttcatgcgcttcgacagcgacgtgggcgagtaccgcgcggtgaccgagctgggg
cggccggatgccaagtactggaacagccagaaggacatcctggaggggacgcgggccgag
gtggacacggtgtgcagacacaactacgaggggctggaggtctcctccctgcggcggctt
gagcagcccaaggtggccatctccctgtccaggaccgaggccctcaaccaccacaacctg
ctggtctgctcggtgacagatttctacccagcccaggtcaaagtgcgctggttccggaac
ggccaggaggagacctcgggggtcgtgtccacgaaacttattaagaacggggactggacc
taccaggtcctggtcatgctggagatgacccctcagcggggagacgcctacacctgccac
gtggagcaccccagcctgcagagccccgtcaccgtggagtggagggcgcagtctgagtct
gcccagggcaagatgctgagtggcatcgggggcttcgtgctcgggctgatcttcctcggc
ctgggccttttcttccgtcacaggagtcagaaaggggcacgagggcctcctcctgcaggg
ctcctacagtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543301
Entry
110543301         CDS       T05884                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain-like isoform X1
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110543301
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543301
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543301
   04612 Antigen processing and presentation
    110543301
   04658 Th1 and Th2 cell differentiation
    110543301
   04659 Th17 cell differentiation
    110543301
   04672 Intestinal immune network for IgA production
    110543301
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110543301
   05322 Systemic lupus erythematosus
    110543301
   05323 Rheumatoid arthritis
    110543301
   05320 Autoimmune thyroid disease
    110543301
   05321 Inflammatory bowel disease
    110543301
   05330 Allograft rejection
    110543301
   05332 Graft-versus-host disease
    110543301
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110543301
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110543301
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110543301
   05152 Tuberculosis
    110543301
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110543301
   05164 Influenza A
    110543301
   05168 Herpes simplex virus 1 infection
    110543301
   05169 Epstein-Barr virus infection
    110543301
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110543301
   05140 Leishmaniasis
    110543301
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543301
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110543301
  Exosomal proteins of epithelial cells
   110543301
  Exosomal proteins of breast milk
   110543301
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig Ig_2 Marek_A DUF5129
Other DBs
NCBI-GeneID: 110543301
NCBI-ProteinID: XP_021485340
LinkDB
Position
Unknown
AA seq 319 aa
MMVPRVPVAPWMVALMVLLSSEVQGEAPPENHLLRALHECHAERDGTQRYLMRCVFNREE
FMRFDSAVGEFRALTAMGRPWAAAWNSQKDYLERRRAEVDTVCAHNYELNQGFTMKRRGV
SQLRNMPHSLCTPGHPGTHCVDQASLKLPEIHLPLPGAKRNLHNHTLLPSALLVQPEVHV
SPAKKVALEHRDLLICHVTDFYPGSIRVRWFRNGQEETAGVVSTELIRNGDWTFQVLVML
EMTPHRGDAYTCRVEHPSLQSPVTVEWRVQSDSARNKMLAGAGGLVLGLIFLAVGIVKHM
RSKQGYTCHSFHSSTVCEV
NT seq 960 nt   +upstreamnt  +downstreamnt
atgatggtcccgagggtccctgtggccccctggatggtggctctgatggtattgctgagc
agcgaggtccagggcgaggcccctccagagaaccacctgctgcgcgcgctgcacgagtgc
cacgcggagagggacgggacgcagcgctaccttatgagatgcgtcttcaaccgcgaggag
ttcatgcgcttcgacagcgccgtgggcgagttccgcgcgctcaccgccatggggcgcccg
tgggccgcggcctggaacagccagaaggactacctggagcgccggagggccgaggtggac
acggtgtgcgcgcacaactacgagctcaaccagggcttcaccatgaagcgccgaggagtc
tcacagctgagaaacatgcctcactcgctatgcacccctggccatcctggaactcactgt
gtagaccaggccagcctcaagctcccagagatccacctgcctctgcctggtgctaaaagg
aatctacacaaccacactctccttccctccgcactcctagtccagcctgaggtacacgtg
tcacccgccaagaaggtcgccctggagcaccgtgacctgctgatctgccacgtgacagat
ttctacccaggcagcatccgggtccgctggttccggaacggccaggaggagacggcgggg
gtcgtgtccaccgaactgatccgaaacggggactggaccttccaggtcctggtcatgctg
gagatgacccctcaccggggagacgcctacacctgccgcgtggagcaccccagcctgcag
agccccgtcaccgtggagtggagggtccagtctgactctgcccgaaacaagatgctggcc
ggagccggtggcctggtgctgggactcatcttcctggcagtgggcatagtcaagcacatg
aggagcaagcagggttatacctgccacagtttccacagctcaacagtctgtgaagtatag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543331
Entry
110543331         CDS       T05884                                 

Definition
(RefSeq) RLA class II histocompatibility antigen, DP alpha-1 chain isoform X1
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110543331
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543331
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543331
   04612 Antigen processing and presentation
    110543331
   04658 Th1 and Th2 cell differentiation
    110543331
   04659 Th17 cell differentiation
    110543331
   04672 Intestinal immune network for IgA production
    110543331
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110543331
   05322 Systemic lupus erythematosus
    110543331
   05323 Rheumatoid arthritis
    110543331
   05320 Autoimmune thyroid disease
    110543331
   05321 Inflammatory bowel disease
    110543331
   05330 Allograft rejection
    110543331
   05332 Graft-versus-host disease
    110543331
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110543331
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110543331
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110543331
   05152 Tuberculosis
    110543331
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110543331
   05164 Influenza A
    110543331
   05168 Herpes simplex virus 1 infection
    110543331
   05169 Epstein-Barr virus infection
    110543331
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110543331
   05140 Leishmaniasis
    110543331
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543331
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110543331
  Exosomal proteins of epithelial cells
   110543331
  Exosomal proteins of breast milk
   110543331
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 110543331
NCBI-ProteinID: XP_021485366
LinkDB
Position
Unknown
AA seq 279 aa
MLQTNAEALGVFLAFLLSLPGSGVIKADHVAVYDIFAQMRQPSGNCVYEFDGDEQFYVDP
DREETVWGLAEFSTAYAFDAQEALSYIASLKNNLRALIQRHNFSQASSEPPEVTVFPKKP
VELGQPNVLICHVDRFFPPVLNITWLRNGQPVMEGTSETTFLPSTELRFHKFHYLTFVPS
LEDVYDCRVEHWGLEQPRLSHWGKHPPPAPRTQGPGIDRTNCGSRFPSEVEEPVQASSEA
METVFCALGLVVGLVGIVTGGVLTVRALHVSCAPQGPLQ
NT seq 840 nt   +upstreamnt  +downstreamnt
atgctccagactaacgctgaagccctgggagtcttcctggcctttctgctgagtctccca
ggatctggggtcatcaaagccgaccacgtggcagtgtacgacatatttgcccagatgcgg
cagccgtcgggtaactgtgtgtatgagtttgacggcgacgagcagttctacgtggacccg
gacagggaggagacggtctggggcctggcggagttcagcacagcctacgcctttgacgcc
caggaggccctgtcctacatcgccagcctgaagaacaacctgagagccctgatacagaga
cacaacttcagccaggcctccagcgagcctcccgaggtgaccgtgttccccaagaagccg
gtagagctgggccagcccaacgtcctcatctgccacgtggacaggttcttccccccagtg
ctcaacatcacatggcttcgtaacgggcagccggtcatggaagggacttcggagaccact
ttcctgcccagcacagagctcaggtttcacaagttccactacctgaccttcgtgccctcc
ctcgaggacgtgtatgactgcagggtggagcactggggcctggagcagccgcgcctcagt
cactggggtaagcaccccccccccgctcccaggacccagggccccggcatagaccgtact
aactgcggctctcggtttccctcagaagtggaggagccagtccaggcgtcgtccgaggcg
atggagaccgtgttctgcgccctgggcctggtggtcggcctggtgggtatcgtcactggc
ggcgtgctcaccgtgagggccctgcacgtcagctgtgccccccagggccccctgcagtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110544088
Entry
110544088         CDS       T05884                                 

Definition
(RefSeq) H-2 class II histocompatibility antigen, A-F alpha chain
  KO
K06752  MHC class II antigen
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04145  Phagosome
mun04514  Cell adhesion molecules
mun04612  Antigen processing and presentation
mun04640  Hematopoietic cell lineage
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05150  Staphylococcus aureus infection
mun05152  Tuberculosis
mun05164  Influenza A
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05322  Systemic lupus erythematosus
mun05323  Rheumatoid arthritis
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110544088
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110544088
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110544088
   04612 Antigen processing and presentation
    110544088
   04658 Th1 and Th2 cell differentiation
    110544088
   04659 Th17 cell differentiation
    110544088
   04672 Intestinal immune network for IgA production
    110544088
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    110544088
   05322 Systemic lupus erythematosus
    110544088
   05323 Rheumatoid arthritis
    110544088
   05320 Autoimmune thyroid disease
    110544088
   05321 Inflammatory bowel disease
    110544088
   05330 Allograft rejection
    110544088
   05332 Graft-versus-host disease
    110544088
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110544088
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110544088
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110544088
   05152 Tuberculosis
    110544088
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110544088
   05164 Influenza A
    110544088
   05168 Herpes simplex virus 1 infection
    110544088
   05169 Epstein-Barr virus infection
    110544088
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110544088
   05140 Leishmaniasis
    110544088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110544088
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110544088
  Exosomal proteins of epithelial cells
   110544088
  Exosomal proteins of breast milk
   110544088
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A SKG6 C2-set_2
Other DBs
NCBI-GeneID: 110544088
NCBI-ProteinID: XP_021485887
LinkDB
Position
Unknown
AA seq 254 aa
MPTSRALILGVLALTALRACGGQDIKADHVGNYGINVYQSYGPNGQYTFEFDGDELFYVD
LDKKETVWRIPEFGQLTSFDPQGGLQEIAAAKHTLEIMIKRSNSTPATNEVPEVTVLPKS
PVLLGQPNILLCLVDNIFPPVVNITWLRNSKSVTDGVYETSFLSNDDHSFQKMSYLTFIP
SDDDVYDCKVEHWGLDEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFIFQ
GLRSGGPSRHPGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atgccgaccagccgcgctctgattctgggggtcctcgccctgaccgcgctccgcgcctgc
ggagggcaagacatcaaggctgatcatgtgggcaactatggtataaatgtctatcagtca
tatggacccaacggccagtacacgtttgaatttgatggtgatgagttgttctatgtggat
ttggataagaaggagactgtctggaggattcctgagtttggccagctgacgagctttgat
ccccaaggtggactgcaagagatagctgcagcaaagcacaccttggaaatcatgattaag
aggtccaactctaccccagctaccaacgaggttcctgaggtgaccgtgcttcccaagtcc
cccgtgctcctgggtcagcccaacatcctcctctgtctggtggacaacatcttcccccct
gtggtcaacatcacgtggttgagaaacagcaagtcagtcacagacggcgtttatgagacc
agcttcctctccaacgatgaccattccttccaaaagatgtcttacctcaccttcatccct
tccgatgatgacgtttacgactgcaaggtggagcactggggcctggacgagccggttctg
aaacactgggaacctgagattccggcccccatgtcagagctgacagagaccgtggtctgt
gccctggggttgtctgtgggcctcgtgggcatcgtggtgggcaccatcttcatcttccaa
ggcctgcggtcaggtggcccctccagacacccagggccattatga

DBGET integrated database retrieval system