KEGG   Meriones unguiculatus (Mongolian gerbil): 110543537
Entry
110543537         CDS       T05884                                 

Gene name
Tapbp
Definition
(RefSeq) tapasin
  KO
K08058  TAP binding protein (tapasin)
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04612  Antigen processing and presentation
mun05163  Human cytomegalovirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110543537 (Tapbp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110543537 (Tapbp)
   05168 Herpes simplex virus 1 infection
    110543537 (Tapbp)
   05163 Human cytomegalovirus infection
    110543537 (Tapbp)
   05169 Epstein-Barr virus infection
    110543537 (Tapbp)
SSDB
Motif
Pfam: C1-set ig Med5
Other DBs
NCBI-GeneID: 110543537
NCBI-ProteinID: XP_021485517
LinkDB
Position
Unknown
AA seq 462 aa
MKPPTLLLAVALGLATVASAGPAAIECWFVEDARGGGLTKKPATLLLRQGPRGPPPRPDL
DPKLYFKVDDPAGTLLAAFRRYPAGAPAPHCEMSRFIPFPASANWARGLIPQQSCPRALD
GDWLLVSVSSTVFSLSSLLRPQPEPQREPVVITMATVVLTVLTHNPAPRIQLGKDAVLDL
RFAYAPPTLEEVSSLDAGPPPFGLEWRRQHRGKGHLLLAATPGLAGEIPPAQEKAVAFAA
WDDSEPWGPWTGNGTFWLPAVKPFQEGVYMATVHLPYLQGQVSLELSVHKTPKVSLTPAP
LVWAAPGEAPPELVCLVSHFYPAEGLRVEWELRGGPEGSFGKAEGDAWLSTARHHSDGSV
SQAGHLRLPPVTAKQHGARYACRVHHPSLPASGHSAEVTLQVAGLSGPSVEDGIGLFLSA
FLLLGLLKALGWTAAYLTTPEGLKEKVTAADLSIPKDSKKSQ
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgaagcctccgaccctgctcctcgccgtggctctgggcctggcgaccgtcgcctccgct
ggaccagcggcgattgagtgctggttcgtggaggacgcgcgtgggggtggcctgaccaag
aaaccggccacattgctgctgcgccagggacccaggggaccgccgccccggccagatctt
gaccctaagctatacttcaaggttgatgatccggcgggaacgctcctggctgccttccgg
cggtaccccgcaggcgcccccgcaccacactgcgagatgagccgcttcatcccgttcccc
gcctcggccaactgggctagaggtctgatcccgcagcagagctgcccgcgggccctggac
ggggattggctgctggtcagcgtgtccagcaccgtcttcagcctctccagcctgctgcga
ccgcagccggagcctcagcgggagcctgtcgtcatcaccatggcaacagtggtgctgacc
gtcctcacccacaaccctgcccctcggatccagctgggaaaagacgcagtgctggacctg
aggttcgcctacgcgcccccaacgctggaagaggtctcctctctggatgcagggcctcct
ccctttgggctggagtggcgacgccagcacaggggcaagggtcacctgctgctggctgca
actcctgggctggctggagaaataccaccagcccaagaaaaggccgtggcatttgccgca
tgggatgacagtgagccctggggcccgtggactgggaatgggaccttctggctgccagca
gtgaaacctttccaggagggcgtctacatggctacggtacacctgccctacctgcaagga
caggtctccctggagctgtctgtgcacaagactcccaaggtgtctctgacaccagcaccc
cttgtgtgggctgccccaggagaggcacccccggagttggtctgtcttgtgtcccacttc
taccctgcggagggcctgagggtggaatgggagctgagaggtggcccagaaggaagtttc
ggaaaggccgagggggatgcgtggctctccactgcccgccaccactccgatggctctgtc
agccaggccgggcacctgcggctgcccccagtcactgccaagcagcacggagcacgctat
gcctgtcgggtccaccacccgagcctgccagcgtcggggcacagtgctgaagtcacgctg
caggtggcaggcctctccggaccctcagtcgaggacggcataggcctgttcctgtctgct
tttctccttctggggctcctcaaggctctaggctggacggctgcctacctgaccactcct
gaaggcttaaaggagaaggtaacagcagccgacctgagcattcctaaagactcgaagaag
tcacagtaa

DBGET integrated database retrieval system